Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aphgo-ACHE1

Aphis gossypii (Cotton aphid) Aphis glycines (Soybean aphid) clone ace1 acetylcholinesterase mRNA, complete cds

Comment
This gene was named ace2 in the first paper of Li but renamed acche1 after the second paper to be consistent with other insect AChE genes. F139L_aphgo-ACHE2 and A302S_aphgo-ACHE1 found together in resistant strains;Li_2004_Insect.Biochem.Mol.Biol_34_397. Q6KAV5 Strain 171B Q6KAV4 Strain 1081K Q6KAV3 Strain 968E Andrews et al 2004. AB180401 AB180402 AB180403 correspond to the Japamese strains S (susceptible) GSM and H-16 (resistant) respectively


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Aphis gossypii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Sternorrhyncha: N E > Aphidomorpha: N E > Aphidoidea: N E > Aphididae: N E > Aphidinae: N E > Aphidini: N E > Aphis [genus]: N E > Aphis [subgenus]: N E > Aphis gossypii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
4 mutations: Table (e.g. : A302S/S431F, A302S, G221A ... more)
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aphgo-ACHE1
Colored MSA for ACHE (raw)
MDQWLLWFGYLVASTYGLSLRHARHQSVGTPTAEEILEPQILIEDTDHVF
RQRASDMFAQEPEYTEKRNLNHRRRSEFSGNQDTNFESSGATYSAYTSDD
PLIIHTNKGKIRGITQEATTGKLVDAWLGIPYAKKPIGDLRFRHPRPIDR
WDTTSPETILNCTTPPNTCVQIFDTLFGDFPGATMWNPNSPVSEDCLYIN
VVVPRPRPQNAAVMVWIFGGGFYSGSATLDIYDPKILVSEENVILVSMQY
RVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTVPWAILSREESFSRGLKLA
KAMGCPDDRNEIHKTVECLRKVNSSAMVEKEWDHVAMCFFPFVPVVDGAF
LDDHPQKSLSTNNFKKTNILMGSNSEEGYYFIFYYLTELFKKEENVVVSR
ENFIKAIGQLNPNADAAVKSAIEFEYTDWFNPNDPEKNRNALDKMVGDYQ
FTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVMHGDEISYVFG
DPLNPNKRYEIEEIELSKKMMRYWTNFAKTGNPSKTLEGSWVTPKWPVRT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLTVISKSMKSDKNCTT
ISGGTKTNMIKLSVWTIVMTTAVLML
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDQWLLWFGYLVASTYGLSLRHARHQSVGTPTAEEILEPQILIEDTDHVF
RQRASDMFAQEPEYTEKRNLNHRRRSEFSGNQDTNFESSGATYSAYTSDD
PLIIHTNKGKIRGITQEATTGKLVDAWLGIPYAKKPIGDLRFRHPRPIDR
WDTTSPETILNCTTPPNTCVQIFDTLFGDFPGATMWNPNSPVSEDCLYIN
VVVPRPRPQNAAVMVWIFGGGFYSGSATLDIYDPKILVSEENVILVSMQY
RVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTVPWAILSREESFSRGLKLA
KAMGCPDDRNEIHKTVECLRKVNSSAMVEKEWDHVAMCFFPFVPVVDGAF
LDDHPQKSLSTNNFKKTNILMGSNSEEGYYFIFYYLTELFKKEENVVVSR
ENFIKAIGQLNPNADAAVKSAIEFEYTDWFNPNDPEKNRNALDKMVGDYQ
FTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVMHGDEISYVFG
DPLNPNKRYEIEEIELSKKMMRYWTNFAKTGNPSKTLEGSWVTPKWPVRT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLTVISKSMKSDKNCTT
ISGGTKTNMIKLSVWTIVMTTAVLML


References
3 more
    Title: Mutations in acetylcholinesterase associated with insecticide resistance in the cotton aphid, Aphis gossypii Glover
    Li F, Han Z
    Ref: Insect Biochemistry & Molecular Biology, 34:397, 2004 : PubMed

            

    Title: Two amino acid substitutions in acetylcholinesterase associated with pirimicarb and organophosphorous insecticide resistance in the cotton aphid, Aphis gossypii Glover (Homoptera: Aphididae)
    Toda S, Komazaki S, Tomita T, Kono Y
    Ref: Insect Molecular Biology, 13:549, 2004 : PubMed

            

    Title: Two different genes encoding acetylcholinesterase existing in cotton aphid (Aphis gossypii)
    Li F, Han ZJ
    Ref: Genome, 45:1134, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer