Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aphgo-ACHE2

Aphis gossypii clone ache2 acetylcholinesterase

Comment
This gene was named ace1 in the first paper of Li but renamed acche2 after the second paper and by Javed et al (strain 171B)trembl Q7YZP9 to be consistent with other insect AChE genes. F139L_aphgo-ACHE2 and A302S_aphgo-ACHE1 found together in resistant strains; Li_2004_Insect.Biochem.Mol.Biol_34_397


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Aphis gossypii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Sternorrhyncha: N E > Aphidomorpha: N E > Aphidoidea: N E > Aphididae: N E > Aphidinae: N E > Aphidini: N E > Aphis [genus]: N E > Aphis [subgenus]: N E > Aphis gossypii: N E


Molecular evidence
Database
1 mutation: aphgo-ACHE2
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AF502081, AJ576071, AB180402
1 UniProt : Q65YU0
1 Ncbi-nid : 22212712
1 Ncbi-pid : 22212713
3 UniProt : Q65YU0, Q8MV36, Q7YZP9
3 Interpro : Q65YU0, Q8MV36, Q7YZP9
3 Prodom : Q65YU0, Q8MV36, Q7YZP9
3 Pfam : Q65YU0, Q8MV36, Q7YZP9
3 PIRSF : Q65YU0, Q8MV36, Q7YZP9
3 SUPERFAM : Q65YU0, Q8MV36, Q7YZP9
Sequence
Graphical view for this peptide sequence: aphgo-ACHE2
Colored MSA for ACHE (raw)
MSVDCVYTSAVTLLLCCSAVLGRPSSNGGADAGGGGGGGGGAGGAGGGGA
GGGGGGGSAVDDTDEIPVVVTSTGLVQGYTKIIANREVRVYTGIPFAKPP
VGQLRFRRPVPVDPWTGVLNATRLPNTCYQERYEYFPGFVGEEMWSPNTK
LSEDCLYLNIWIPKKQRTRHHSNNAHHAKIPVLVWIYGGGYMSGTSTLDI
YDGDLLAATFDVMIASMQYRLGAFGSLYLTPELPEDSDDAPGNMGLWDQA
LAIKWIKENAAAFGADPETITLFGESAGGGSVSVHLISPETGGMVKRGII
QSGTVNAPWSYMTGERAVEIAKKLLDDCNCNSTSLDSNPIGTMSCMRPVD
ASTISKKQWNSYSGILGFPSAPTVDGILLPEHPLDMLAKANFSDIDILIG
SNLNEGTYFLLYDFVDFFDRTSATALPREKFVQIVNVIFKDRTQLERDAI
IYQYSGWEKKEVDDIYSNQKQLSDVVADYFFVCPTNLFANIVSSRGARVY
YYFFTHRTDSHLWGDWMGVLHGDEMQYVFGHLLNMSMPYNARERDLSIRI
MEAFTRFSLTGTPVSDDIDWPLYNESKPIYHVWNAAEMHVGYGPRAAECQ
FWNGFFPKIAQALKETSKTTCEDYPDSMPTINENCTFTSSFATVNPQISF
TIIFIFVLPAYGLF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVDCVYTSAVTLLLCCSAVLGRPSSNGGADAGGGGGGGGGAGGAGGGGA
GGGGGGGSAVDDTDEIPVVVTSTGLVQGYTKIIANREVRVYTGIPFAKPP
VGQLRFRRPVPVDPWTGVLNATRLPNTCYQERYEYFPGFVGEEMWSPNTK
LSEDCLYLNIWIPKKQRTRHHSNNAHHAKIPVLVWIYGGGYMSGTSTLDI
YDGDLLAATFDVMIASMQYRLGAFGSLYLTPELPEDSDDAPGNMGLWDQA
LAIKWIKENAAAFGADPETITLFGESAGGGSVSVHLISPETGGMVKRGII
QSGTVNAPWSYMTGERAVEIAKKLLDDCNCNSTSLDSNPIGTMSCMRPVD
ASTISKKQWNSYSGILGFPSAPTVDGILLPEHPLDMLAKANFSDIDILIG
SNLNEGTYFLLYDFVDFFDRTSATALPREKFVQIVNVIFKDRTQLERDAI
IYQYSGWEKKEVDDIYSNQKQLSDVVADYFFVCPTNLFANIVSSRGARVY
YYFFTHRTDSHLWGDWMGVLHGDEMQYVFGHLLNMSMPYNARERDLSIRI
MEAFTRFSLTGTPVSDDIDWPLYNESKPIYHVWNAAEMHVGYGPRAAECQ
FWNGFFPKIAQALKETSKTTCEDYPDSMPTINENCTFTSSFATVNPQISF
TIIFIFVLPAYGLF


References
1 more
    Title: Mutations in acetylcholinesterase associated with insecticide resistance in the cotton aphid, Aphis gossypii Glover
    Li F, Han Z
    Ref: Insect Biochemistry & Molecular Biology, 34:397, 2004 : PubMed

            

    Title: Characterization of acetylcholinesterases, and their genes, from the hemipteran species Myzus persicae (Sulzer), Aphis gossypii (Glover), Bemisia tabaci (Gennadius) and Trialeurodes vaporariorum (Westwood)
    Javed N, Viner R, Williamson MS, Field LM, Devonshire AL, Moores GD
    Ref: Insect Molecular Biology, 12:613, 2003 : PubMed

            

    Title: Two different genes encoding acetylcholinesterase existing in cotton aphid (Aphis gossypii)
    Li F, Han ZJ
    Ref: Genome, 45:1134, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer