arall-d7krm0

MDTLRFELSSACFTSAVAAPSLHSHSRHFFSSLQLGRVGSSSPAITSVAR
TTENEICTADELHYVPVPNSDWRVALWRYLPSQKAPKRNHPLLLLSGIGT
NAVTYDLSPKCSFARFMSGSGFDTWILELRGAGLSSLSVDTNLGKGNSQQ
RIVSNLLENFISVSERLENVLDGGSKILGMQDRLSKRAGDFKQRLELIPH
YNWDFDNYLEEDVLSAMNYVRTQTKSKDGKLLAVGHSMGGILLYALLSRC
GFKGMDSGLAAVTTLASTFDYSSSGTLLKYLLPMKEPAQAINLPIMPIDT
MLAMVHPLMCRPPYALSWLTANISAPQMMDPEVIEKLVLNSLSTVPVKLL
LQLTTAVDHGGLRDRTGTFCYKDHISKSNVPILALAGDWDIICPPDAVYD
TVKLIPEHLATFKVLGSPGGPHYGHQDLISGRSAPNEVYPLITRFLQQHD
EI

Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)> Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J, Gundlach H, Haberer G, Hollister JD, Ossowski S, Ottilar RP, Salamov AA, Schneeberger K, Spannagl M, Wang X, Yang L, Nasrallah ME, Bergelson J, Carrington JC, Gaut BS, Schmutz J, Mayer KF, Van de Peer Y, Grigoriev IV, Nordborg M, Weigel D, Guo YL (- 20)
Ref: Nat Genet, 43:476, 2011 : PubMed
Abstract


ESTHER: Hu_2011_Nat.Genet_43_476
PubMedSearch: Hu 2011 Nat.Genet 43 476
PubMedID: 21478890
Gene_locus related to this paper: arall-d7kc59, arall-d7kfz1, arall-d7kjk9, arall-d7kk58, arall-d7kuj1, arall-d7kwx5, arall-d7kzq8, arall-d7laf7, arall-D7LAK6, arall-d7ltj2, arall-d7lu11, arall-d7ly06, arall-d7lyn6, arall-d7m1k0, arall-d7m1k1, arall-d7m1k3, arall-d7m1l4, arall-d7m814, arall-d7mbk0, arall-d7mbn8, arall-d7mgs1, arall-d7mi04, arall-d7mld7, arall-d7mpg7, arall-d7mul9, arath-At2g45610, arath-At1g05790, arath-At1g09980, arath-At1g18360, arath-AT1G29120, arath-AT1G73920, arath-AT1G76140, arath-AT2G05260, arath-At2g15230, arath-At2g24280, arath-AT2G42690, arath-At2g47630, arath-AT3G12150, arath-At3g61680, arath-AT3g62590, arath-AT4G00500, arath-AT4G25770, arath-AT4g30610, arath-At5g11650, arath-At5g13640, arath-AT5G19050, arath-AT5G20060, arath-AT5G20520, arath-AT5G27320, arath-At5g42930, arath-At5g47330, arath-CGEP, arath-clh1, arath-clh2, arath-F1N13.220, arath-F2G14.100, arath-F12A4.4, arath-F14O10.2, arath-SCP27, arath-HNL, arath-GID1B, arath-LIP2, arath-At5g17670, arath-pip, arath-PLA11, arath-PLA12, arath-PLA13, arath-PLA15, arath-PLA17, arath-Q8LPF5, arath-Q9FFZ1, arath-Q9FJ29, arath-Q9FKP9, arath-Q9FNF6, arath-q9lhe8, arath-Q9SFF6, arath-q84w08, arath-SCP7, arath-SCP8, arath-SCP26, arath-SCP28, arath-SCP33, arath-SCP40, arath-SCPL34, arath-At4g12230, arath-MES14, arath-T19F11.2, arath-MES10, arath-At5g11790, arath-T26B15.8, arath-ZW18, arall-d7l971, arall-d7lfd3, arall-d7lg04, arall-d7lg05, arall-d7lg06, arall-d7lg07, arall-d7mb17, arall-d7mb18, arall-d7l7v2, arall-d7l7v3, arall-d7lst0, arall-d7lfw9, arall-d7mgs6, arall-d7mur3, arall-d7kjr5, arall-d7l7v1, arall-d7ls88, arall-d7kzg6, arall-d7kcm6, arall-d7krm0, arall-d7kwe4, arall-d7lri7

Abstract

We report the 207-Mb genome sequence of the North American Arabidopsis lyrata strain MN47 based on 8.3x dideoxy sequence coverage. We predict 32,670 genes in this outcrossing species compared to the 27,025 genes in the selfing species Arabidopsis thaliana. The much smaller 125-Mb genome of A. thaliana, which diverged from A. lyrata 10 million years ago, likely constitutes the derived state for the family. We found evidence for DNA loss from large-scale rearrangements, but most of the difference in genome size can be attributed to hundreds of thousands of small deletions, mostly in noncoding DNA and transposons. Analysis of deletions and insertions still segregating in A. thaliana indicates that the process of DNA loss is ongoing, suggesting pervasive selection for a smaller genome. The high-quality reference genome sequence for A. lyrata will be an important resource for functional, evolutionary and ecological studies in the genus Arabidopsis.