arall-d7kwx5

 
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Prolyl oligopeptidase family protein

Relationship
Block X
Arabidopsis lyrata subsp. lyrata position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis lyrata: N E > Arabidopsis lyrata subsp. lyrata: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : GL348714
1 UniProt : D7KWX5
1 UniProtTrembl : D7KWX5
1 Interpro : D7KWX5
1 Prodom : D7KWX5
1 Pfam : D7KWX5
1 PIRSF : D7KWX5
1 SUPERFAM : D7KWX5
1 QuickSwissBlast : D7KWX5
 
Sequence
Graphical view for this peptide sequence: arall-d7kwx5
Colored MSA for S9N_PREPL_Peptidase_S9 (raw)
MAVTSLLRRYKPATISSVLSFSTQCFVGRTSSLSVPAEAPPVPKKIPLAI
SSHGITRQDPYRWMKNTDDSDFVDFLKRENSYAQAFMADTETLRRDLVSE
MKTRIPEELFTPPERWGQWSYRQYIPKAKEYPLLCRRLEKVKTNWLSGLF
RGGEEEVVLDWNQIAEQFGYVHVGVCRVSPDHNYLAYTVDPEGDGITLFY
TVADENQRPHRVVVTNVESDGRDDAVVFTERDSSFCVDITTTKDGKFVTI
NSNSRTSSEVYIVNADKPMTGLQRARERVPGVQCFLEHHNGFFYILTNSP
SNAISEWSGEGYYLTRCLVEGKEASDWQTVFCPDDDVVIQDMDMFNDYLV
LFLNKNGLPMLCSIDMPIKAHTKHMDDLVPWYFPLPFDSCSVAPGSNHNF
QSSIYRVVLSSPVIPDTIVDYDVSRRLFSIVQQEGGVLDNSDSSKPWYAA
DRSIENSDKLNDRTSEGEDGPRMPKWEDSSDAYVCERQEVSSHDGVEVPL
TILYSREAWKKSESPGMLIGYGAYGEVLDKSWCTNRLSMLDRGWVIAFAD
VRGGGSGDFSWHKSGTRLLKQNSIQDFIYSAKYLIEKGYVHRHHLAAIGY
SAGAILPAAAMNMHPSLFQAAILKVPFVDVLNTLSDPNLPLTLLDHEEFG
NPDNLTDFRSILSYSPYDNIRKDVCYPSMLVTTSFHDSRVGVWEGAKWVA
KIRDSTCHDCSRAVILRTNMNGGHFGEGGRYAQCEETAFDYAFLLKVMGY
HNNR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAVTSLLRRYKPATISSVLSFSTQCFVGRTSSLSVPAEAPPVPKKIPLAI
SSHGITRQDPYRWMKNTDDSDFVDFLKRENSYAQAFMADTETLRRDLVSE
MKTRIPEELFTPPERWGQWSYRQYIPKAKEYPLLCRRLEKVKTNWLSGLF
RGGEEEVVLDWNQIAEQFGYVHVGVCRVSPDHNYLAYTVDPEGDGITLFY
TVADENQRPHRVVVTNVESDGRDDAVVFTERDSSFCVDITTTKDGKFVTI
NSNSRTSSEVYIVNADKPMTGLQRARERVPGVQCFLEHHNGFFYILTNSP
SNAISEWSGEGYYLTRCLVEGKEASDWQTVFCPDDDVVIQDMDMFNDYLV
LFLNKNGLPMLCSIDMPIKAHTKHMDDLVPWYFPLPFDSCSVAPGSNHNF
QSSIYRVVLSSPVIPDTIVDYDVSRRLFSIVQQEGGVLDNSDSSKPWYAA
DRSIENSDKLNDRTSEGEDGPRMPKWEDSSDAYVCERQEVSSHDGVEVPL
TILYSREAWKKSESPGMLIGYGAYGEVLDKSWCTNRLSMLDRGWVIAFAD
VRGGGSGDFSWHKSGTRLLKQNSIQDFIYSAKYLIEKGYVHRHHLAAIGY
SAGAILPAAAMNMHPSLFQAAILKVPFVDVLNTLSDPNLPLTLLDHEEFG
NPDNLTDFRSILSYSPYDNIRKDVCYPSMLVTTSFHDSRVGVWEGAKWVA
KIRDSTCHDCSRAVILRTNMNGGHFGEGGRYAQCEETAFDYAFLLKVMGY
HNNR

no DNA




Reference
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer