arath-AT2G03550

 
Arabidopsis thaliana (Mouse-ear cress) AtCXE7 putative esterase T4M8.1 at2g03550

Relationship
Block H
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : BT015034, AAO41964, AC006284
1 Ncbi-pid : 28393060
1 UniProtTrembl : Q9ZQ91
1 Interpro : Q9ZQ91
1 Prodom : Q9ZQ91
1 Pfam : Q9ZQ91
1 PIRSF : Q9ZQ91
1 SUPERFAM : Q9ZQ91
1 QuickSwissBlast : Q9ZQ91
1 Tair database : AT2G03550
 
Sequence
Graphical view for this peptide sequence: arath-AT2G03550
Colored MSA for Plant_carboxylesterase (raw)
MDSVIAFDRSPMFRVYKSGRIERLLGETTVPPSLTPQNGVVSKDIIHSPE
KNLSLRIYLPEKVTVKKLPILIYFHGGGFIIETAFSPPYHTFLTSAVAAA
NCLAISVNYRRAPEFPVPIPYEDSWDSLKWVLTHITGTGPETWINKHGDF
GKVFLAGDSAGGNISHHLTMRAKKEKLCDSLISGIILIHPYFWSKTPIDE
FEVRDVGKTKGVEGSWRVASPNSKQGVDDPWLNVVGSDPSGLGCGRVLVM
VAGDDLFVRQGWCYAEKLKKSGWEGEVEVMETKNEGHVFHLKNPNSDNAR
QVVKKLEEFINK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDSVIAFDRSPMFRVYKSGRIERLLGETTVPPSLTPQNGVVSKDIIHSPE
KNLSLRIYLPEKVTVKKLPILIYFHGGGFIIETAFSPPYHTFLTSAVAAA
NCLAISVNYRRAPEFPVPIPYEDSWDSLKWVLTHITGTGPETWINKHGDF
GKVFLAGDSAGGNISHHLTMRAKKEKLCDSLISGIILIHPYFWSKTPIDE
FEVRDVGKTKGVEGSWRVASPNSKQGVDDPWLNVVGSDPSGLGCGRVLVM
VAGDDLFVRQGWCYAEKLKKSGWEGEVEVMETKNEGHVFHLKNPNSDNAR
QVVKKLEEFINK

no DNA




References
    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer