arath-AT2G42690

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) putative lipase

Relationship
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AC006931
2 UniProt : Q9SJI7, D7LJB9
2 UniProtTrembl : Q9SJI7, D7LJB9
2 Interpro : Q9SJI7, D7LJB9
2 Prodom : Q9SJI7, D7LJB9
2 Pfam : Q9SJI7, D7LJB9
2 PIRSF : Q9SJI7, D7LJB9
2 SUPERFAM : Q9SJI7, D7LJB9
2 QuickSwissBlast : Q9SJI7, D7LJB9
1 Tair database : AT2G42690
 
Sequence
Graphical view for this peptide sequence: arath-AT2G42690
Colored MSA for Plant_phospholipase (raw)
MATTTTSWEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQ
NSKYCGASRYGKSSFFDKVMLENASDYEVVNFLYATARVSLPEGLLLQSQ
SRDSWDRESNWFGYIAVTSDERSKALGRREIYIALRGTSRNYEWVNVLGA
RPTSADPLLHGPEQDGSGGVVEGTTFDSDSEDEEGCKVMLGWLTIYTSNH
PESKFTKLSLRSQLLAKIKELLLKYKDEKPSIVLTGHSLGATEAVLAAYD
IAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMSHKNLKILHVRNTIDLLT
RYPGGLLGYVDIGINFVIDTKKSPFLSDSRNPGDWHNLQAMLHVVAGWNG
KKGEFKLMVKRSIALVNKSCEFLKAECLVPGSWWVEKNKGLIKNEDGEWV
LAPVEEEPVPEF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATTTTSWEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQ
NSKYCGASRYGKSSFFDKVMLENASDYEVVNFLYATARVSLPEGLLLQSQ
SRDSWDRESNWFGYIAVTSDERSKALGRREIYIALRGTSRNYEWVNVLGA
RPTSADPLLHGPEQDGSGGVVEGTTFDSDSEDEEGCKVMLGWLTIYTSNH
PESKFTKLSLRSQLLAKIKELLLKYKDEKPSIVLTGHSLGATEAVLAAYD
IAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMSHKNLKILHVRNTIDLLT
RYPGGLLGYVDIGINFVIDTKKSPFLSDSRNPGDWHNLQAMLHVVAGWNG
KKGEFKLMVKRSIALVNKSCEFLKAECLVPGSWWVEKNKGLIKNEDGEWV
LAPVEEEPVPEF

no DNA




References
4 more
    Title: Analysis of multiple occurrences of alternative splicing events in Arabidopsis thaliana using novel sequenced full-length cDNAs
    Iida K, Fukami-Kobayashi K, Toyoda A, Sakaki Y, Kobayashi M, Seki M, Shinozaki K
    Ref: DNA Research, 16:155, 2009 : PubMed

            

    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer