arath-AT4g30610

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)putative serine carboxypeptidase II protein AT4g30610

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AF370198, AL161577, BT002334
3 UniProt : Q9M099, D7MBU0, Q9M099
1 Ncbi-nid : 13877870
1 Ncbi-pid : 13877871
2 UniProtTrembl : Q9M099, D7MBU0
2 Interpro : Q9M099, D7MBU0
2 Prodom : Q9M099, D7MBU0
2 Pfam : Q9M099, D7MBU0
2 PIRSF : Q9M099, D7MBU0
2 SUPERFAM : Q9M099, D7MBU0
2 QuickSwissBlast : Q9M099, D7MBU0
1 Tair database : AT4g30610
 
Sequence
Graphical view for this peptide sequence: arath-AT4g30610
Colored MSA for Carboxypeptidase_S10 (raw)
MARTHFIFLLLVALLSTTFPSSSSSREQEKDRIKALPGQPKVAFSQYSGY
VNVNQSHGRALFYWLTESSSPSPHTKPLLLWLNGGPGCSSIAYGASEEIG
PFRINKNGSNLYLNKFAWNKDANLLFLESPAGVGYSYTNTSSDLKDSGDE
RTAQDNLIFLIKWLSRFPQYKYRDFYIAGESYAGHYVPQLAKKINDYNKA
FSKPIINLKGFLVGNAVTDNQYDSIGTVTYWWTHAIISDKSYKSILKYCN
FTVERVSDDCDNAVNYAMNHEFGDIDQYSIYTPTCVAAQQKKNTTGFFVR
MKNTLLRRRLVSGYDPCTESYAEKYFNRPDVQRAMHANVTGIRYKWTACS
DVLIKTWKDSDKTMLPIYKELAASGLRIWIFSGDTDSVVPVTATRFSLSH
LNLPVKTRWYPWYTDNQVGGWTEVYKGLTFATVRGAGHEVPLFEPKRALI
LFRSFLAGKELPRSY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARTHFIFLLLVALLSTTFPSSSSSREQEKDRIKALPGQPKVAFSQYSGY
VNVNQSHGRALFYWLTESSSPSPHTKPLLLWLNGGPGCSSIAYGASEEIG
PFRINKNGSNLYLNKFAWNKDANLLFLESPAGVGYSYTNTSSDLKDSGDE
RTAQDNLIFLIKWLSRFPQYKYRDFYIAGESYAGHYVPQLAKKINDYNKA
FSKPIINLKGFLVGNAVTDNQYDSIGTVTYWWTHAIISDKSYKSILKYCN
FTVERVSDDCDNAVNYAMNHEFGDIDQYSIYTPTCVAAQQKKNTTGFFVR
MKNTLLRRRLVSGYDPCTESYAEKYFNRPDVQRAMHANVTGIRYKWTACS
DVLIKTWKDSDKTMLPIYKELAASGLRIWIFSGDTDSVVPVTATRFSLSH
LNLPVKTRWYPWYTDNQVGGWTEVYKGLTFATVRGAGHEVPLFEPKRALI
LFRSFLAGKELPRSY

Graphical view for this nucleotide DNA sequence (1636 bp): arath-AT4g30610



References
4 more
    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: BRS1, a serine carboxypeptidase, regulates BRI1 signaling in Arabidopsis thaliana
    Li J, Lease KA, Tax FE, Walker JC
    Ref: Proc Natl Acad Sci U S A, 98:5916, 2001 : PubMed

            

    Title: Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana
    Mayer K, Schuller C, Wambutt R, Murphy G, Volckaert G, Pohl T, Dusterhoft A, Stiekema W, Entian KD and McCombie WR <220 more author(s)>
    Ref: Nature, 402:769, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer