Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT5G39220

Arabidopsis thaliana (Mouse-ear cress) AT5G39220 seed-specific esterase regulator of tocopherol content AtVTE7

Comment
uncharacterized, seed-specific esterase (VTE7) localized to the chloroplast envelope


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : BT004189, BT005407, AB010694
2 UniProt : A0A178UBH3, A0A654G7A7
>3 UniProt links 1 more: Q84JL7, Q9FL85, A0A178UBH3
>3 Interpro links 1 more: Q84JL7, Q9FL85, A0A178UBH3
>3 Prodom links 1 more: Q84JL7, Q9FL85, A0A178UBH3
>3 Pfam links 1 more: Q84JL7, Q9FL85, A0A178UBH3
>3 PIRSF links 1 more: Q84JL7, Q9FL85, A0A178UBH3
>3 SUPERFAM links 1 more: Q84JL7, Q9FL85, A0A178UBH3
1 Tair database : AT5G39220
Sequence
Graphical view for this peptide sequence: arath-AT5G39220
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MMGSLKIISPPPPATRFRQRVTANGDGFPTFLPKEIQNIKDPFARALAQR
IVRIPVPLQMGNFRGSVMSSCIKPLVQLHDKSPVVLLHCFDSSCLEWRRT
YPLLEQACLETWAIDVLGWGFSDLEKLPPCDAASKRHHLFELWKTYIKRP
MILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGRLKELPKSIA
YAGVKLLKSFPLRLLANVLAFCSSPLSENIDWTNIGRLHCQMPWWEDAMV
DFMISGGYNVASHIKHIDHKTLVVCSENDQIVSNQLSVKLLCELANAVLR
EVPDSGHLPHVENPKHIVKLISDFASGKLY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMGSLKIISPPPPATRFRQRVTANGDGFPTFLPKEIQNIKDPFARALAQR
IVRIPVPLQMGNFRGSVMSSCIKPLVQLHDKSPVVLLHCFDSSCLEWRRT
YPLLEQACLETWAIDVLGWGFSDLEKLPPCDAASKRHHLFELWKTYIKRP
MILVGPSLGATVAVDFTATYPEAVDKLVLINANAYSEGTGRLKELPKSIA
YAGVKLLKSFPLRLLANVLAFCSSPLSENIDWTNIGRLHCQMPWWEDAMV
DFMISGGYNVASHIKHIDHKTLVVCSENDQIVSNQLSVKLLCELANAVLR
EVPDSGHLPHVENPKHIVKLISDFASGKLY


References
    Title: Genome-wide association identifies a missing hydrolase for tocopherol synthesis in plants
    Albert E, Kim S, Magallanes-Lundback M, Bao Y, Deason N, Danilo B, Wu D, Li X, Wood JC and DellaPenna D <3 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 119:e2113488119, 2022 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. V. Sequence features of the regions of 1,381,565 bp covered by twenty one physically assigned P1 and TAC clones
    Kaneko T, Kotani H, Nakamura Y, Sato S, Asamizu E, Miyajima N, Tabata S
    Ref: DNA Research, 5:131, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer