arath-At1g18360

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AtMAGL2 at1g18360 / f15h18_2 Alpha/beta-hydrolase domain-containing protein

Comment
monoacylglycerol lipase, utilized also lysophosphatidylethanolamine as substrate, targeted to the chloroplasts. (Q9LPQ4 identical to AY070740 At1g18360 F15H18_2 ?)


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AY070740, AC013354, NM_101694
1 UniProt : D7KGD5
3 UniProtTrembl : Q8VYJ0, D7KGD5, Q9LPQ4
3 Interpro : Q8VYJ0, D7KGD5, Q9LPQ4
3 Prodom : Q8VYJ0, D7KGD5, Q9LPQ4
3 Pfam : Q8VYJ0, D7KGD5, Q9LPQ4
3 PIRSF : Q8VYJ0, D7KGD5, Q9LPQ4
3 SUPERFAM : Q8VYJ0, D7KGD5, Q9LPQ4
3 QuickSwissBlast : Q8VYJ0, D7KGD5, Q9LPQ4
1 Tair database : At1g18360
 
Sequence
Graphical view for this peptide sequence: arath-At1g18360
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MICSSKGTVVIATRSSFPRLLNRIQNRNDVPISVIATRRSSMSVEAFPMR
LKSSQKKRKMNIGCGVSPSSPTTTVVDEEVAIRRKLAMRRVLEDNGGDGS
SVRDFSLFTTKRGDTLFTQSWTPVDSAKNRGLVVLLHGLNEHSGRYSDFA
KQLNVNGFKVYGIDWIGHGGSDGLHAYVPSLDYAVADLKSFIEKVIAENP
GLPCFCIGHSTGGAIILKAMLDAKIEARVSGIVLTSPAVGVQPTYPIFGV
IAPFLSFLIPRYQLSAAKKKIMPVSRDPEALLAKYSDPLVYTGFIRARTG
NEILRLGAHLLQNLNRIKVPFLVMHGTADTVTDPKGTQKLYNEASSSDKS
IKLYDGLLHDLLFEPERETIAGVILDWLNRRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MICSSKGTVVIATRSSFPRLLNRIQNRNDVPISVIATRRSSMSVEAFPMR
LKSSQKKRKMNIGCGVSPSSPTTTVVDEEVAIRRKLAMRRVLEDNGGDGS
SVRDFSLFTTKRGDTLFTQSWTPVDSAKNRGLVVLLHGLNEHSGRYSDFA
KQLNVNGFKVYGIDWIGHGGSDGLHAYVPSLDYAVADLKSFIEKVIAENP
GLPCFCIGHSTGGAIILKAMLDAKIEARVSGIVLTSPAVGVQPTYPIFGV
IAPFLSFLIPRYQLSAAKKKIMPVSRDPEALLAKYSDPLVYTGFIRARTG
NEILRLGAHLLQNLNRIKVPFLVMHGTADTVTDPKGTQKLYNEASSSDKS
IKLYDGLLHDLLFEPERETIAGVILDWLNRRV

no DNA




References
    Title: Molecular and biochemical characterizations of the monoacylglycerol lipase gene family of Arabidopsis thaliana
    Kim RJ, Kim HJ, Shim D, Suh MC
    Ref: Plant J, 85:758, 2016 : PubMed

            

    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer