Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-At1g73750

Arabidopsis thaliana (Mouse-ear cress) At1g73750/F25P22.17

Comment
Q8W568 Q9C9T7 different alternative splicing?


Relationship
Family|UCP031088
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AF419606, AY113044, AC012679
1 UniProt : A0A178W668
3 UniProt : Q8W568, Q9C9T7, A0A178W668
3 Interpro : Q8W568, Q9C9T7, A0A178W668
3 Pfam : Q8W568, Q9C9T7, A0A178W668
3 PIRSF : Q8W568, Q9C9T7, A0A178W668
3 SUPERFAM : Q8W568, Q9C9T7, A0A178W668
1 Tair database : At1g73750
Sequence
Graphical view for this peptide sequence: arath-At1g73750
Colored MSA for UCP031088 (raw)
MDTLRFELSSASFTSAVTASSLHSHSRYFFSSVQLGRVGSSSPAITSVSR
TTVNEICTADELHYVPVPNSDWRVALWRYLPSPKAPKRNHPLLLLSGIGT
NAVTYDLSPECSFARSMSGSGFDTWILELRGAGLSSLSVDTNLGKGNNQQ
RIVSNLLENFISVSERLENVLDGGSKILGMQDRLSKRAGDFKQRFELIPH
YNWDFDNYLEEDVPSAMDYVRTQTKSKDGKLLAVGHSMGGILLYALLSRC
GFKGMDSGLAGVTTLASTFDYSSSGTLLKYLLPMKEPAQAINLPIMPIDT
MLAMAHPLMCRPPYSLSWLTANISAPQMMDPEVIEKLVLNSLCTVPVKLL
LQLTTAVDHGGLRDRTGTFCYKDHISKTNVPILALAGDWDIICPPDAVYD
TVKLIPEHLATYKVVGSPGGPHYGHQDLISGRTARNEVYPLITRFLQQQD
ES
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDTLRFELSSASFTSAVTASSLHSHSRYFFSSVQLGRVGSSSPAITSVSR
TTVNEICTADELHYVPVPNSDWRVALWRYLPSPKAPKRNHPLLLLSGIGT
NAVTYDLSPECSFARSMSGSGFDTWILELRGAGLSSLSVDTNLGKGNNQQ
RIVSNLLENFISVSERLENVLDGGSKILGMQDRLSKRAGDFKQRFELIPH
YNWDFDNYLEEDVPSAMDYVRTQTKSKDGKLLAVGHSMGGILLYALLSRC
GFKGMDSGLAGVTTLASTFDYSSSGTLLKYLLPMKEPAQAINLPIMPIDT
MLAMAHPLMCRPPYSLSWLTANISAPQMMDPEVIEKLVLNSLCTVPVKLL
LQLTTAVDHGGLRDRTGTFCYKDHISKTNVPILALAGDWDIICPPDAVYD
TVKLIPEHLATYKVVGSPGGPHYGHQDLISGRTARNEVYPLITRFLQQQD
ES


References
    Title: Chromosome-level assembly of Arabidopsis thaliana Ler reveals the extent of translocation and inversion polymorphisms
    Zapata L, Ding J, Willing EM, Hartwig B, Bezdan D, Jiao WB, Patel V, Velikkakam James G, Koornneef M and Schneeberger K <1 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 113:E4052, 2016 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer