arath-At2g24280

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At2g24280/f27d4.19

Comment
some differences between Q93Z34 et At2g24280


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AY058177
3 UniProt : Q8S8L0, Q93Z34, D7LHJ0
3 UniProtTrembl : Q8S8L0, Q93Z34, D7LHJ0
3 Interpro : Q8S8L0, Q93Z34, D7LHJ0
3 Prodom : Q8S8L0, Q93Z34, D7LHJ0
3 Pfam : Q8S8L0, Q93Z34, D7LHJ0
3 PIRSF : Q8S8L0, Q93Z34, D7LHJ0
3 SUPERFAM : Q8S8L0, Q93Z34, D7LHJ0
3 QuickSwissBlast : Q8S8L0, Q93Z34, D7LHJ0
1 Tair database : At2g24280
 
Sequence
Graphical view for this peptide sequence: arath-At2g24280
Colored MSA for Prolylcarboxypeptidase (raw)
MSACLCLVFLFFSIVAEATYSPGGFHHLSSLRLKKKVSKSKHELPFETRY
FPQNLDHFSFTPDSYKVFHQKYLINNRFWRKGGPIFVYTGNEGDIDWFAS
NTGFMLDIAPKFRALLVFIEHRFYGESTPFGKKSHKSAETLGYLNSQQAL
ADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALAS
SAPILHFDNIVPLTSFYDAISQDFKDASINCFKVIKRSWEELEAVSTMKN
GLQELSKKFRTCKGLHSQYSARDWLSGAFVYTAMVNYPTAANFMAPLPGY
PVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGL
DGWQYQACTEMVMPMSCSNQSMLPPYENDSEAFQEQCMTRYGVKPRPHWI
TTEFGGMRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKK
GAHHADLRAATKDDPEWLKEQRRQEVAIIEKWISEYYRDLREEQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSACLCLVFLFFSIVAEATYSPGGFHHLSSLRLKKKVSKSKHELPFETRY
FPQNLDHFSFTPDSYKVFHQKYLINNRFWRKGGPIFVYTGNEGDIDWFAS
NTGFMLDIAPKFRALLVFIEHRFYGESTPFGKKSHKSAETLGYLNSQQAL
ADYAILIRSLKQNLSSEASPVVVFGGSYGGMLAAWFRLKYPHITIGALAS
SAPILHFDNIVPLTSFYDAISQDFKDASINCFKVIKRSWEELEAVSTMKN
GLQELSKKFRTCKGLHSQYSARDWLSGAFVYTAMVNYPTAANFMAPLPGY
PVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEKCFEMEQQTDDHGL
DGWQYQACTEMVMPMSCSNQSMLPPYENDSEAFQEQCMTRYGVKPRPHWI
TTEFGGMRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKK
GAHHADLRAATKDDPEWLKEQRRQEVAIIEKWISEYYRDLREEQ

no DNA




References
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer