arath-At2g26740

 
Arabidopsis thaliana chromosome II (ATsEH) epoxide hydrolase At2g26740 auxin inducible

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Cis-stilbene-oxide ,

2 Genbank : AC003105, D16628
2 Ncbi-nid : 6598390, 1109599
2 Ncbi-pid : 2760840, 1109600
2 UniProtTrembl : Q944I9, Q42566
2 Interpro : Q944I9, Q42566
2 Prodom : Q944I9, Q42566
2 Pfam : Q944I9, Q42566
2 PIRSF : Q944I9, Q42566
2 SUPERFAM : Q944I9, Q42566
2 QuickSwissBlast : Q944I9, Q42566
1 Tair database : At2g26740
 
Sequence
Graphical view for this peptide sequence: arath-At2g26740
Colored MSA for Epoxide_hydrolase (raw)
MEHRKVRGNGIDIHVAIQGPSDGPIVLLLHGFPELWYSWRHQIPGLAARG
YRAVAPDLRGYGDSDAPAEISSYTCFNIVGDLIAVISALTASEDEKVFVV
GHDWGALIAWYLCLFRPDRVKALVNLSVPFSFRPTDPSVKPVDRMRAFYG
DDYYICRFQEFGDVEAEIAEVGTERVMKRLLTYRTPGPVIIPKDKSFWGS
KGETIPLPSWLTEEDVAYFVSKFEEKGFSGPVNYYRNFNRNNELLGPWVG
SKIQVPTKFVIGELDLVYYMPGVKEYIHGPQFKEDVPLLEEPVVMEGVAH
FINQEKPQEILQIILDFISKF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEHRKVRGNGIDIHVAIQGPSDGPIVLLLHGFPELWYSWRHQIPGLAARG
YRAVAPDLRGYGDSDAPAEISSYTCFNIVGDLIAVISALTASEDEKVFVV
GHDWGALIAWYLCLFRPDRVKALVNLSVPFSFRPTDPSVKPVDRMRAFYG
DDYYICRFQEFGDVEAEIAEVGTERVMKRLLTYRTPGPVIIPKDKSFWGS
KGETIPLPSWLTEEDVAYFVSKFEEKGFSGPVNYYRNFNRNNELLGPWVG
SKIQVPTKFVIGELDLVYYMPGVKEYIHGPQFKEDVPLLEEPVVMEGVAH
FINQEKPQEILQIILDFISKF

Graphical view for this nucleotide DNA sequence (1150 bp): arath-At2g26740



References
1 more
    Title: Cress and potato soluble epoxide hydrolases: purification, biochemical characterization, and comparison to mammalian enzymes
    Morisseau C, Beetham JK, Pinot F, Debernard S, Newman JW, Hammock BD
    Ref: Archives of Biochemistry & Biophysics, 378:321, 2000 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            

    Title: Characterization of an Arabidopsis cDNA for a soluble epoxide hydrolase gene that is inducible by auxin and water stress
    Kiyosue T, Beetham JK, Pinot F, Hammock BD, Yamaguchi-Shinozaki K, Shinozaki K
    Ref: Plant J, 6:259, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer