Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-At3g14360

Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata Oil body lipase 1 AtOBL1: TAG, DAG and 1-MAG lipase

Comment
Other strains: Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp.


Relationship
Family|Triacylglycerol-lipase-OBL1-like
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: arath-At3g14360
Colored MSA for Triacylglycerol-lipase-OBL1-like (raw)
MHKDNDSGSGSNPGQVSNYLIVRPHRGGYIDLFRYGVRDDQTSKAKFLEM
PDNREWSTITIDEEAEDHRWVIVVSILVRKIIRLLRTPMEFTGFVVDFFL
NLFSANGGFFGLLLRLIQAKVVIPERGSVTFVSTIGQLDGRISLYKEWNF
VEHLEGIDSVDSGRVKIELGSRGLMDLCVMASKLAYENAKMNLVEFLDCW
NDYQKQMSTQVFVFTDKQKDANLIVISFRGTEPFDADDWGTDFDYSWYEV
PNVGKLHMGFLEAMGLGNRDDTTTFHYNLFEQTSSEEENSKKNLLDMVER
SAYYAVRVILKRLLSEHENARFVVTGHSLGGALAILFPTLLVLNEETEIM
KRLLGVYTFGQPRIGNREVGLFMKAQLNQPVDRYFRVVYCNDIVPRLPYD
DKTFLYKHFGLCLFYDSFYNETKAEDEPDPNPYGLRYKILGHVIAVWELV
RGLTMGYTHGPDYKEGWFRILFRLMGLVIPGLSDHCMTDYVNSVRLGPDN
ELQMSSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHKDNDSGSGSNPGQVSNYLIVRPHRGGYIDLFRYGVRDDQTSKAKFLEM
PDNREWSTITIDEEAEDHRWVIVVSILVRKIIRLLRTPMEFTGFVVDFFL
NLFSANGGFFGLLLRLIQAKVVIPERGSVTFVSTIGQLDGRISLYKEWNF
VEHLEGIDSVDSGRVKIELGSRGLMDLCVMASKLAYENAKMNLVEFLDCW
NDYQKQMSTQVFVFTDKQKDANLIVISFRGTEPFDADDWGTDFDYSWYEV
PNVGKLHMGFLEAMGLGNRDDTTTFHYNLFEQTSSEEENSKKNLLDMVER
SAYYAVRVILKRLLSEHENARFVVTGHSLGGALAILFPTLLVLNEETEIM
KRLLGVYTFGQPRIGNREVGLFMKAQLNQPVDRYFRVVYCNDIVPRLPYD
DKTFLYKHFGLCLFYDSFYNETKAEDEPDPNPYGLRYKILGHVIAVWELV
RGLTMGYTHGPDYKEGWFRILFRLMGLVIPGLSDHCMTDYVNSVRLGPDN
ELQMSSL


References
    Title: Characterization of the enzymatic activity and physiological function of the lipid droplet-associated triacylglycerol lipase AtOBL1
    Muller AO, Ischebeck T
    Ref: New Phytol, 217:1062, 2018 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 3. I. Sequence features of the regions of 4,504,864 bp covered by sixty P1 and TAC clones
    Sato S, Nakamura Y, Kaneko T, Katoh T, Asamizu E, Tabata S
    Ref: DNA Research, 7:131, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer