arath-At3g52570

 
Arabidopsis thaliana (Mouse-ear cress) At3g52570/F22O6_50 hypothetical protein

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AL050300, AY074573, AY097393
2 UniProtTrembl : Q9SVD8, Q8VXV0
2 Interpro : Q9SVD8, Q8VXV0
2 Prodom : Q9SVD8, Q8VXV0
2 Pfam : Q9SVD8, Q8VXV0
2 PIRSF : Q9SVD8, Q8VXV0
2 SUPERFAM : Q9SVD8, Q8VXV0
2 QuickSwissBlast : Q9SVD8, Q8VXV0
1 Tair database : At3g52570
 
Sequence
Graphical view for this peptide sequence: arath-At3g52570
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MARTRIITNRFESRFLIRFLESPTLFASCFTSSRSLQTLAYEEVRTSGDR
ESESTALILHGLLGSGRNWRSFSRSLASSLSVSSASDWKMILVDLRNHGR
SAEVEGLNPPHDLVNSAKDLADLVKASGWNWPDVVIGHSLGGKVALQFME
SCARGDFGESASPPKQQRLFGAEQLWVLDSVPGEVKAEKSDGEVEKVLKT
LQSLPSSIPSRKWLVDRMVELGFSRSLSEWIGSNLKRSGDSETWTFNLDG
AVQMFNSYRETSYWSLLENPPKETEINFVIAEKSDRWDNDTTKRLETIAN
QRQNVAEGKVATHLLRNSGHWVHTDNPKGLLEIVSPNFFSPHE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARTRIITNRFESRFLIRFLESPTLFASCFTSSRSLQTLAYEEVRTSGDR
ESESTALILHGLLGSGRNWRSFSRSLASSLSVSSASDWKMILVDLRNHGR
SAEVEGLNPPHDLVNSAKDLADLVKASGWNWPDVVIGHSLGGKVALQFME
SCARGDFGESASPPKQQRLFGAEQLWVLDSVPGEVKAEKSDGEVEKVLKT
LQSLPSSIPSRKWLVDRMVELGFSRSLSEWIGSNLKRSGDSETWTFNLDG
AVQMFNSYRETSYWSLLENPPKETEINFVIAEKSDRWDNDTTKRLETIAN
QRQNVAEGKVATHLLRNSGHWVHTDNPKGLLEIVSPNFFSPHE

no DNA




No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer