Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-At4g18550

Arabidopsis thaliana (Mouse-ear cress) DSEL Phospholipase A1-IIgamma lipase-like protein

Comment
AtDSEL, Arabidopsis cytosolic DAD1-like acylhydrolase, is involved in negative regulation of storage oil mobilization during seedling establishment


Relationship
Family|Plant_phospholipase
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
2 structures: 2YIJ, 7X0C
No kinetic





No Substrate
No inhibitor
2 Genbank : AL021710, AL161548
1 UniProt : O49523
2 Structure : 7X0C, 2YIJ
1 UniProt : O49523
1 Interpro : O49523
1 Prodom : O49523
1 Pfam : O49523
1 PIRSF : O49523
1 SUPERFAM : O49523
1 Tair database : At4g18550
Sequence
Graphical view for this peptide sequence: arath-At4g18550
Colored MSA for Plant_phospholipase (raw)
MKRKKKEEEEEKLIVTREFAKRWRDLSGQNHWKGMLQPLDQDLREYIIHY
GEMAQAGYDTFNINTESQFAGASIYSRKDFFAKVGLEIAHPYTKYKVTKF
IYATSDIHVPESFLLFPISREGWSKESNWMGYVAVTDDQGTALLGRRDIV
VSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYMSQDER
SPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIV
ANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNL
PDVIPIYPPIGYSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVAG
TQGTNKADLFRLDVERAIGLVNKSVDGLKDECMVPGKWRVLKNKGMAQQD
DGSWELVDHEIDDNEDLDF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRKKKEEEEEKLIVTREFAKRWRDLSGQNHWKGMLQPLDQDLREYIIHY
GEMAQAGYDTFNINTESQFAGASIYSRKDFFAKVGLEIAHPYTKYKVTKF
IYATSDIHVPESFLLFPISREGWSKESNWMGYVAVTDDQGTALLGRRDIV
VSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYMSQDER
SPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIV
ANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNL
PDVIPIYPPIGYSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVAG
TQGTNKADLFRLDVERAIGLVNKSVDGLKDECMVPGKWRVLKNKGMAQQD
DGSWELVDHEIDDNEDLDF


References
    Title: Crystal Structures of the Plant Phospholipase A1 Proteins Reveal a Unique Dimerization Domain
    Heo Y, Lee I, Moon S, Yun JH, Kim EY, Park SY, Park JH, Kim WT, Lee W
    Ref: Molecules, 27:, 2022 : PubMed

            

    Title: AtDSEL, an Arabidopsis cytosolic DAD1-like acylhydrolase, is involved in negative regulation of storage oil mobilization during seedling establishment
    Kim EY, Seo YS, Kim WT
    Ref: J Plant Physiol, 168:1705, 2011 : PubMed

            

    Title: Analysis of 1.9 Mb of contiguous sequence from chromosome 4 of Arabidopsis thaliana.
    Bevan M, Bancroft I, Bent E, Love K, Goodman H, Dean C, Bergkamp R, Dirkse W, van Staveren M and Chalwatzis N <58 more author(s)>
    Ref: Nature, 391:485, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer