Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-At5g11650

Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), AtMAGL13, T22P22.40, At5g11650, lysophospholipase-like protein

Comment
AtMAGL13 monoacylglycerol lipase, could not be expressed as maltose-binding protein fusion in E.Coli; targeted to the endoplasmic reticulum.Kim et al.2016


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AL163814, NM_121203
>3 UniProt links 2 more: Q9LYG5, Q8LEE3, D7M4A8
>3 UniProt links 2 more: Q9LYG5, Q8LEE3, D7M4A8
>3 Interpro links 2 more: Q9LYG5, Q8LEE3, D7M4A8
>3 Prodom links 2 more: Q9LYG5, Q8LEE3, D7M4A8
>3 Pfam links 2 more: Q9LYG5, Q8LEE3, D7M4A8
>3 PIRSF links 2 more: Q9LYG5, Q8LEE3, D7M4A8
>3 SUPERFAM links 2 more: Q9LYG5, Q8LEE3, D7M4A8
1 Tair database : At5g11650
Sequence
Graphical view for this peptide sequence: arath-At5g11650
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MASTSAEMDQLTSGASNRIIFILRTLRKCLVFVLSLVLSLLLILRLRPRR
RVSPLSSPEDEAVPAPSRRWRRKMAWKLEEEDTARRRSLAEGVEMAGDGE
ISCSLFYGRRGNALFSRSWLPISGELRGILIIIHGLNEHSGRYSQFAKQL
NASNLGVYAMDWIGHGGSDGLHGYVPSLDYVVSDTEAFLEKIRSENPGVP
CFLFGHSTGGAVVLKAASSPSIEDMLAGIVLTSPALRVKPAHPIVGAIAP
IFSLLAPRFQFKGANKRGIPVSRDPEALLAKYSDPLVYTGPIRVRTGYEI
LRITAYLTRNFKSVTVPFFVLHGTEDKVTDPLASQDLYNQAPSVFKDIKL
YDGFLHDLLFEPEREEVGRDIIDWMMNRLDDVNGSAASLW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASTSAEMDQLTSGASNRIIFILRTLRKCLVFVLSLVLSLLLILRLRPRR
RVSPLSSPEDEAVPAPSRRWRRKMAWKLEEEDTARRRSLAEGVEMAGDGE
ISCSLFYGRRGNALFSRSWLPISGELRGILIIIHGLNEHSGRYSQFAKQL
NASNLGVYAMDWIGHGGSDGLHGYVPSLDYVVSDTEAFLEKIRSENPGVP
CFLFGHSTGGAVVLKAASSPSIEDMLAGIVLTSPALRVKPAHPIVGAIAP
IFSLLAPRFQFKGANKRGIPVSRDPEALLAKYSDPLVYTGPIRVRTGYEI
LRITAYLTRNFKSVTVPFFVLHGTEDKVTDPLASQDLYNQAPSVFKDIKL
YDGFLHDLLFEPEREEVGRDIIDWMMNRLDDVNGSAASLW


References
2 more
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Features of Arabidopsis genes and genome discovered using full-length cDNAs
    Alexandrov NN, Troukhan ME, Brover VV, Tatarinova T, Flavell RB, Feldmann KA
    Ref: Plant Mol Biol, 60:69, 2006 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer