Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-At5g16120

Arabidopsis thaliana (Mouse-ear cress) AtMAGL15 T21H19_40 At5g16120 lipase-like protein

Comment
Q9LF16 and Q9C5I9 quasi identical. Here Q9LF16 AtMAGL15 monoacylglycerol lipase, Has MAGL activity, targeted to the cytosol. Kim et al.2016


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AL391148, NM_121617, AF360219
1 UniProt : B3H7N1
3 UniProt : Q9LF16, Q9C5I9, B3H7N1
3 Interpro : Q9LF16, Q9C5I9, B3H7N1
3 Prodom : Q9LF16, Q9C5I9, B3H7N1
3 Pfam : Q9LF16, Q9C5I9, B3H7N1
3 PIRSF : Q9LF16, Q9C5I9, B3H7N1
3 SUPERFAM : Q9LF16, Q9C5I9, B3H7N1
1 Tair database : At5g16120
Sequence
Graphical view for this peptide sequence: arath-At5g16120
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MAPTATLDNNEELRRLREVNIDEAPGRRRVRDSLKDIQLNLDHILFKTPE
NGIKTKESFEVNSRGVEIFSKSWLPEASKPRALVCFCHGIARRLALSGYG
VFAMDYPGFGLSEGLHGYIPSFDLLVQDVIEHYSNIKANPEFSSLPSFLF
GQSMGGAVSLKIHLKQPNAWAGAVLLAPMCKIADDLVPPPVLKQILIGLA
NVLPKHKLVPQKDLAEAGFRDIRKRDMTPYNMICYSGKPRLRTAVEMLRT
TQDIEKQLQEVSLPILILHGEADTVTDPSVSRELYEKAKSPDKKIVLYEN
AYHSLLEGEPDDMILRVLSDIISWLNDHSLQAEGSSVTTM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPTATLDNNEELRRLREVNIDEAPGRRRVRDSLKDIQLNLDHILFKTPE
NGIKTKESFEVNSRGVEIFSKSWLPEASKPRALVCFCHGIARRLALSGYG
VFAMDYPGFGLSEGLHGYIPSFDLLVQDVIEHYSNIKANPEFSSLPSFLF
GQSMGGAVSLKIHLKQPNAWAGAVLLAPMCKIADDLVPPPVLKQILIGLA
NVLPKHKLVPQKDLAEAGFRDIRKRDMTPYNMICYSGKPRLRTAVEMLRT
TQDIEKQLQEVSLPILILHGEADTVTDPSVSRELYEKAKSPDKKIVLYEN
AYHSLLEGEPDDMILRVLSDIISWLNDHSLQAEGSSVTTM


References
    Title: Molecular and biochemical characterizations of the monoacylglycerol lipase gene family of Arabidopsis thaliana
    Kim RJ, Kim HJ, Shim D, Suh MC
    Ref: Plant J, 85:758, 2016 : PubMed

            

    Title: Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana
    Tabata S, Kaneko T, Nakamura Y, Kotani H, Kato T, Asamizu E, Miyajima N, Sasamoto S, Kimura T and Fransz P <119 more author(s)>
    Ref: Nature, 408:823, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer