Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-CXE6

Arabidopsis thaliana AtCXE6 F24J5.14 At1g68620 Putative carboxylesterase

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AC008075, CP002684, AF370151
1 UniProt : Q9SX25
1 Ncbi-nid : 5724802
1 Ncbi-pid : 5734715
1 UniProt : Q9SX25
1 Interpro : Q9SX25
1 Prodom : Q9SX25
1 Pfam : Q9SX25
1 PIRSF : Q9SX25
1 SUPERFAM : Q9SX25
1 Tair database : At1g68620
Sequence
Graphical view for this peptide sequence: arath-CXE6
Colored MSA for Plant_carboxylesterase (raw)
MGGTKLTHVTTTNPNNSNIHGPVVDEVEGLIKVYKDGHVERSQLLPCVDP
SLPLELGVTCSDVVIDKLTNVWARLYVPMTTTKSSVSKLPLIVYFHGGGF
CVGSASWLCYHEFLARLSARSRCLVMSVNYRLAPENPLPAAYEDGVNAIL
WLNKARNDNLWAKQCDFGRIFLAGDSAGGNIAQQVAARLASPEDLALKIE
GTILIQPFYSGEERTESERRVGNDKTAVLTLASSDAWWRMSLPRGANREH
PYCKPVKMIIKSSTVTRTLVCVAEMDLLMDSNMEMCDGNEDVIKRVLHKG
VGHAFHILGKSQLAHTTTLEMLCQIDAFIHHYDPLN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGGTKLTHVTTTNPNNSNIHGPVVDEVEGLIKVYKDGHVERSQLLPCVDP
SLPLELGVTCSDVVIDKLTNVWARLYVPMTTTKSSVSKLPLIVYFHGGGF
CVGSASWLCYHEFLARLSARSRCLVMSVNYRLAPENPLPAAYEDGVNAIL
WLNKARNDNLWAKQCDFGRIFLAGDSAGGNIAQQVAARLASPEDLALKIE
GTILIQPFYSGEERTESERRVGNDKTAVLTLASSDAWWRMSLPRGANREH
PYCKPVKMIIKSSTVTRTLVCVAEMDLLMDSNMEMCDGNEDVIKRVLHKG
VGHAFHILGKSQLAHTTTLEMLCQIDAFIHHYDPLN


References
    Title: Araport11: a complete reannotation of the Arabidopsis thaliana reference genome
    Cheng CY, Krishnakumar V, Chan AP, Thibaud-Nissen F, Schobel S, Town CD
    Ref: Plant J, 89:789, 2017 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer