Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-F14G24.3

Arabidopsis thaliana (Mouse-ear cress) AtMAGL3 Caffeoyl shikimate esterase F14G24.3/AT1G52760

Comment
AtMAGL3 monoacylglycerol lipase, Has MAGL activity, targeted to the endoplasmic reticulum and/or Golgi network. Kim et al.2016. Esterase involved in the biosynthesis of lignin. Hydrolyzes caffeoylshikimate into caffeate and shikimate. Together with 4-coumarate--CoA ligase (4CL), acts on an alternative reaction for the formation of caffeoyl-CoA and bypasses the second reaction of shikimate O-hydroxycinnamoyltransferase (HST). Accepts also 4-coumaroylshikimate as substrate, but with lower activity. Posseses monoacylglycerol O-acyltransferase, monoacylglycerol lipase and lysophospholipase activities in vitro.


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Caffeoylshikimate
No inhibitor
>3 Genbank links 2 more: AAG52273, AEE32849, AAK96768
2 UniProt : Q9C942, A0A5S9WP41
2 UniProt : Q9C942, A0A5S9WP41
2 Interpro : Q9C942, A0A5S9WP41
2 Prodom : Q9C942, A0A5S9WP41
2 Pfam : Q9C942, A0A5S9WP41
2 PIRSF : Q9C942, A0A5S9WP41
2 SUPERFAM : Q9C942, A0A5S9WP41
1 Tair database : AT1G52760
Sequence
Graphical view for this peptide sequence: arath-F14G24.3
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MPSEAESSANSAPATPPPPPNFWGTMPEEEYYTSQGVRNSKSYFETPNGK
LFTQSFLPLDGEIKGTVYMSHGYGSDTSWMFQKICMSFSSWGYAVFAADL
LGHGRSDGIRCYMGDMEKVAATSLAFFKHVRCSDPYKDLPAFLFGESMGG
LVTLLMYFQSEPETWTGLMFSAPLFVIPEDMKPSKAHLFAYGLLFGLADT
WAAMPDNKMVGKAIKDPEKLKIIASNPQRYTGKPRVGTMRELLRKTQYVQ
ENFGKVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKTLKIYEGMYHSL
IQGEPDENAEIVLKDMREWIDEKVKKYGSKTA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPSEAESSANSAPATPPPPPNFWGTMPEEEYYTSQGVRNSKSYFETPNGK
LFTQSFLPLDGEIKGTVYMSHGYGSDTSWMFQKICMSFSSWGYAVFAADL
LGHGRSDGIRCYMGDMEKVAATSLAFFKHVRCSDPYKDLPAFLFGESMGG
LVTLLMYFQSEPETWTGLMFSAPLFVIPEDMKPSKAHLFAYGLLFGLADT
WAAMPDNKMVGKAIKDPEKLKIIASNPQRYTGKPRVGTMRELLRKTQYVQ
ENFGKVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKTLKIYEGMYHSL
IQGEPDENAEIVLKDMREWIDEKVKKYGSKTA


References
5 more
    Title: CRISPR-Knockout of CSE Gene Improves Saccharification Efficiency by Reducing Lignin Content in Hybrid Poplar
    Jang HA, Bae EK, Kim MH, Park SJ, Choi NY, Pyo SW, Lee C, Jeong HY, Lee H and Ko JH <1 more author(s)>
    Ref: Int J Mol Sci, 22:, 2021 : PubMed

            

    Title: Molecular and biochemical characterizations of the monoacylglycerol lipase gene family of Arabidopsis thaliana
    Kim RJ, Kim HJ, Shim D, Suh MC
    Ref: Plant J, 85:758, 2016 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer