Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-F16B3.4

Arabidopsis thaliana (Mouse-ear cress) F16B3.4 At3g02410 Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2

Comment
There is a difference in exons in Q1PET6 and Q9M899


Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AC021640, DQ446631, DQ653064
2 UniProt : Q1PET6, A0A178V7M1
1 Ncbi-nid : 6957700
1 Ncbi-pid : 6957704
2 UniProt : Q1PET6, A0A178V7M1
2 Interpro : Q1PET6, A0A178V7M1
2 Prodom : Q1PET6, A0A178V7M1
2 Pfam : Q1PET6, A0A178V7M1
2 PIRSF : Q1PET6, A0A178V7M1
2 SUPERFAM : Q1PET6, A0A178V7M1
1 Tair database : At3g02410
Sequence
Graphical view for this peptide sequence: arath-F16B3.4
Colored MSA for BD-FAE (raw)
MQLSPERCRPMSENREAWSANSEEMELLHGSNRLSSPEHVRRRVSGNSSE
DGSPRICRQQSFGRDIGHAAAETYLITRLSFNLLGYLGVGYRWITRLLAL
ACYAMLLMPGFLQVAYLYFFSSQVRRSIVYGGHPRNRLDLYIPPTSDGLK
PVVVFVTGGAWIIGYKAWGSLLGLQLAERDIIVACLDYRNFPQGTISDMV
SDAAQGISFVCNNISAFGGDPNRIYLMGQSAGAHISSCALFEQAIKESRG
ESISWSVSQIKAYFGLSGGYNLFNLVEHFHNRGLYRSIFLSIMEGEESFK
QFSPEVRLKDLNVRKAAALLPHIILFHGSADYSIPPEASKTFTDALQAAE
VKAELVMYKGKTHTDLFLQDPLRGGKDELFDHIVSMIHADDSDALRNDAV
APPRKRLVPEFLLKLAGRVSPF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQLSPERCRPMSENREAWSANSEEMELLHGSNRLSSPEHVRRRVSGNSSE
DGSPRICRQQSFGRDIGHAAAETYLITRLSFNLLGYLGVGYRWITRLLAL
ACYAMLLMPGFLQVAYLYFFSSQVRRSIVYGGHPRNRLDLYIPPTSDGLK
PVVVFVTGGAWIIGYKAWGSLLGLQLAERDIIVACLDYRNFPQGTISDMV
SDAAQGISFVCNNISAFGGDPNRIYLMGQSAGAHISSCALFEQAIKESRG
ESISWSVSQIKAYFGLSGGYNLFNLVEHFHNRGLYRSIFLSIMEGEESFK
QFSPEVRLKDLNVRKAAALLPHIILFHGSADYSIPPEASKTFTDALQAAE
VKAELVMYKGKTHTDLFLQDPLRGGKDELFDHIVSMIHADDSDALRNDAV
APPRKRLVPEFLLKLAGRVSPF


References
1 more
    Title: Characterization, sub-cellular localization and expression profiling of the isoprenylcysteine methylesterase gene family in Arabidopsis thaliana
    Lan P, Li W, Wang H, Ma W
    Ref: BMC Plant Biol, 10:212, 2010 : PubMed

            

    Title: Isoprenylcysteine methylation and demethylation regulate abscisic acid signaling in Arabidopsis
    Huizinga DH, Omosegbon O, Omery B, Crowell DN
    Ref: Plant Cell, 20:2714, 2008 : PubMed

            

    Title: Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana
    Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Blocker H, Perez-Alonso M and Tabata S <127 more author(s)>
    Ref: Nature, 408:820, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer