Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-F1N13.220

Arabidopsis thaliana; Arabidopsis lyrata AtCXE17 At5g16080 F1N13.220 chromosome 5

Comment
Other strains; Arabidopsis thaliana; Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: AL391145, AY087623, CP002688
2 UniProt : Q9LFR7, D7M810
1 Ncbi-nid : 9755632
1 Ncbi-pid : 9755654
3 UniProt : Q9LFR7, Q8LAT4, D7M810
3 Interpro : Q9LFR7, Q8LAT4, D7M810
3 Pfam : Q9LFR7, Q8LAT4, D7M810
3 PIRSF : Q9LFR7, Q8LAT4, D7M810
3 SUPERFAM : Q9LFR7, Q8LAT4, D7M810
1 Tair database : At5g16080
Sequence
Graphical view for this peptide sequence: arath-F1N13.220
Colored MSA for Plant_carboxylesterase (raw)
MATISFSHNHQSSDNRRGGSHHHRHGPVVEEIEGLIKVFNDGCVERPPIV
PIVSPTIHPSSKATAFDIKLSNDTWTRVYIPDAAAASPSVTLPLLVYFHG
GGFCVGSAAWSCYHDFLTSLAVKARCVIVSVNYRLAPEHRLPAAYDDGVN
VVSWLVKQQISTGGGYPSWLSKCNLSNVFLAGDSAGANIAYQVAVRIMAS
GKYANTLHLKGIILIHPFFGGESRTSSEKQQHHTKSSALTLSASDAYWRL
ALPRGASRDHPWCNPLMSSAGAKLPTTMVFMAEFDILKERNLEMCKVMRS
HGKRVEGIVHGGVGHAFHILDNSSVSRDRIHDMMCRLHNFIHPS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATISFSHNHQSSDNRRGGSHHHRHGPVVEEIEGLIKVFNDGCVERPPIV
PIVSPTIHPSSKATAFDIKLSNDTWTRVYIPDAAAASPSVTLPLLVYFHG
GGFCVGSAAWSCYHDFLTSLAVKARCVIVSVNYRLAPEHRLPAAYDDGVN
VVSWLVKQQISTGGGYPSWLSKCNLSNVFLAGDSAGANIAYQVAVRIMAS
GKYANTLHLKGIILIHPFFGGESRTSSEKQQHHTKSSALTLSASDAYWRL
ALPRGASRDHPWCNPLMSSAGAKLPTTMVFMAEFDILKERNLEMCKVMRS
HGKRVEGIVHGGVGHAFHILDNSSVSRDRIHDMMCRLHNFIHPS


References
1 more
    Title: Araport11: a complete reannotation of the Arabidopsis thaliana reference genome
    Cheng CY, Krishnakumar V, Chan AP, Thibaud-Nissen F, Schobel S, Town CD
    Ref: Plant J, 89:789, 2017 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana
    Tabata S, Kaneko T, Nakamura Y, Kotani H, Kato T, Asamizu E, Miyajima N, Sasamoto S, Kimura T and Fransz P <119 more author(s)>
    Ref: Nature, 408:823, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer