Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-F22K18.40

Arabidopsis thaliana (Mouse-ear cress) ABAPT1 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase. F22K18.40 At4g24760

Relationship
Family|ABHD17-depalmitoylase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AL035356, AL161562, AY084912
2 UniProt : Q9SB70, Q8VYE6
2 Interpro : Q9SB70, Q8VYE6
2 Prodom : Q9SB70, Q8VYE6
2 Pfam : Q9SB70, Q8VYE6
2 PIRSF : Q9SB70, Q8VYE6
2 SUPERFAM : Q9SB70, Q8VYE6
1 Tair database : At4g24760
Sequence
Graphical view for this peptide sequence: arath-F22K18.40
Colored MSA for ABHD17-depalmitoylase (raw)
MGGVTSSMAAKLAFFPPNPPSYKLVRDETTELFLMSPFPHRENVDILRLP
TRRGTEIVAMYIRYPMAVTTLLYSHGNAADIGQMYELFIELSIHLRVNLM
GYDYSGYGQSSGKPTEQNTYADIEAAYKCLEENYGAKQENIILYGQSVGS
GPTVDLAARLPRLRASILHSPILSGLRVMYPVKRTYWFDIYKNIDKITLV
RCPVLVIHGTADDVVDFSHGKQLWELCQEKYEPLWLKGGNHCDLELFPEY
IGHLKKFVSAVEKSASKRNSSFSRRSMEGCEQPPRHSVDAPRKSKDGREK
PRKSIDRLRFQGYKLSHIEKPEKLKVPFEEMERSRRSVDIYRDKSQPMER
ARKSVDWLDRSRATE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGGVTSSMAAKLAFFPPNPPSYKLVRDETTELFLMSPFPHRENVDILRLP
TRRGTEIVAMYIRYPMAVTTLLYSHGNAADIGQMYELFIELSIHLRVNLM
GYDYSGYGQSSGKPTEQNTYADIEAAYKCLEENYGAKQENIILYGQSVGS
GPTVDLAARLPRLRASILHSPILSGLRVMYPVKRTYWFDIYKNIDKITLV
RCPVLVIHGTADDVVDFSHGKQLWELCQEKYEPLWLKGGNHCDLELFPEY
IGHLKKFVSAVEKSASKRNSSFSRRSMEGCEQPPRHSVDAPRKSKDGREK
PRKSIDRLRFQGYKLSHIEKPEKLKVPFEEMERSRRSVDIYRDKSQPMER
ARKSVDWLDRSRATE


References
    Title: An ABHD17-like hydrolase screening system to identify de-S-acylation enzymes of protein substrates in plant cells
    Liu X, Li M, Li Y, Chen Z, Zhuge C, Ouyang Y, Zhao Y, Lin Y, Xie Q and Lai J <1 more author(s)>
    Ref: Plant Cell, :, 2021 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer