arath-F2G14.100

 
Arabidopsis thaliana (Mouse-ear cress) AtMAGL14 AT5G14980 lysophospholipase-like protein

Comment
AtMAGL14 monoacylglycerol lipase, Has MAGL activity, targeted to the endoplasmic reticulum and/or Golgi network. Kim et al.2016


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AL391146, GL348717
1 UniProt : D7LSB1
2 UniProtTrembl : Q9LFQ7, D7LSB1
2 Interpro : Q9LFQ7, D7LSB1
2 Prodom : Q9LFQ7, D7LSB1
2 Pfam : Q9LFQ7, D7LSB1
2 PIRSF : Q9LFQ7, D7LSB1
2 SUPERFAM : Q9LFQ7, D7LSB1
2 QuickSwissBlast : Q9LFQ7, D7LSB1
1 Tair database : AT5G14980
 
Sequence
Graphical view for this peptide sequence: arath-F2G14.100
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MGLHPVSEANASSPFGSLSAAEFYSRHSVTHSSAYVTNPTGLKLFTQWWT
PLNRPPLGLIAVVHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSD
GLTAHIPNINLIVDDCISFFDDFRKRHASSFLPAFLYSESLGGAIALYIT
LRQKHQWNGLILSGAMCSISHKFKPPWPLQHLLTLAATLIPTWRVVPTRG
SIAGVSFKEPWKRKLAYANPNRTVGKPRAATAYELVRVCEDLQNRFEEVE
VPLMIVHGRDDVVCDPASVEELYRRCSSRDKTIKIYPGMWHQLIGESEEN
VDLVFGDVLDWIKTRSEISTIHGGTKA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLHPVSEANASSPFGSLSAAEFYSRHSVTHSSAYVTNPTGLKLFTQWWT
PLNRPPLGLIAVVHGFTGESSWFLQLTSVLFAKSGYLTCAIDHQGHGFSD
GLTAHIPNINLIVDDCISFFDDFRKRHASSFLPAFLYSESLGGAIALYIT
LRQKHQWNGLILSGAMCSISHKFKPPWPLQHLLTLAATLIPTWRVVPTRG
SIAGVSFKEPWKRKLAYANPNRTVGKPRAATAYELVRVCEDLQNRFEEVE
VPLMIVHGRDDVVCDPASVEELYRRCSSRDKTIKIYPGMWHQLIGESEEN
VDLVFGDVLDWIKTRSEISTIHGGTKA

no DNA




References
    Title: Molecular and biochemical characterizations of the monoacylglycerol lipase gene family of Arabidopsis thaliana
    Kim RJ, Kim HJ, Shim D, Suh MC
    Ref: Plant J, 85:758, 2016 : PubMed

            

    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones.
    Asamizu E, Sato S, Kaneko T, Nakamura Y, Kotani H, Miyajima N, Tabata S
    Ref: DNA Research, 5:379, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer