Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-KAI2.D14L

Arabidopsis thaliana (Mouse-ear cress) At4g37470 KAI2 AtKAI2 HTL hyposensitive to light

Comment
orthologue to rice OsDLK1 paralogue to AtD14 DWARF14 KARRIKIN INSENSITIVE2 (KAI2) karrikin receptor. Involved in seed germination and seedling development. Essential for plant responses to karrikins, a class of butenolide compounds, structurally similar to strigolactones, released from burning vegetation that stimulate seed germination and enhance seedling photomorphogenesis. KAI2 is not required for strigolactone-mediated responses, but MAX2 is necessary for responses to karrikins and strigolactones. Lacks detectable hydrolase activity against karrikin. Karrikin binding induces a conformational change. Mutations in KAI2, encoding the proposed karrikin receptor, result in hypersensitivity to water deprivation. HYPOSENSITIVE TO LIGHT or HTL. Mutant displayed a long hypocotyl phenotype under red, far-red, and blue light


Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
8 structures (e.g. : 3W06, 4HRX, 4HRY... more)
No kinetic





6 substrates (e.g. : 7-carba-4BD, Contalactone, GR24... more)
7 inhibitors (e.g. : 4-Br-Debranone, 4-CN-Debranone, 4-CN-desmethyl-Debranone... more)
2 Genbank : AL035601, AL161591
>3 Structure links 5 more: 5YZ7, 5Z9G, 5Z9H
1 UniProt : Q9SZU7
1 Interpro : Q9SZU7
1 Prodom : Q9SZU7
1 Pfam : Q9SZU7
1 PIRSF : Q9SZU7
1 SUPERFAM : Q9SZU7
1 Tair database : At4g37470
Sequence
Graphical view for this peptide sequence: arath-KAI2.D14L
Colored MSA for RsbQ-like (raw)
MGVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYD
NMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMI
GVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNY
KAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQ
ILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQL
SSPDSVIPVILRHIRNDIAM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYD
NMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMI
GVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNY
KAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQ
ILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQL
SSPDSVIPVILRHIRNDIAM


References
13 more
    Title: KAI2 regulates seedling development by mediating light-induced remodelling of auxin transport
    Hamon-Josse M, Villaecija Aguilar JA, Ljung K, Leyser O, Gutjahr C, Bennett T
    Ref: New Phytol, :, 2022 : PubMed

            

    Title: Three mutations repurpose a plant karrikin receptor to a strigolactone receptor
    Arellano-Saab A, Bunsick M, Al Galib H, Zhao W, Schuetz S, Bradley JM, Xu Z, Adityani C, Subha A and Lumba S <7 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 118:, 2021 : PubMed

            

    Title: Desmethyl butenolides are optimal ligands for karrikin receptor proteins
    Yao J, Scaffidi A, Meng Y, Melville KT, Komatsu A, Khosla A, Nelson DC, Kyozuka J, Flematti GR, Waters MT
    Ref: New Phytol, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer