arath-MES3
Arabidopsis thaliana (Mouse-ear cress) AtMES3 Methylesterase 3, putative acetone-cyanohydrin lyase At2g23610 F26B6.26
Relationship
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain. > cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
6_AlphaBeta_hydrolase :
arath-AT1G74640 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein ,
arath-AT1G78210 Arabidopsis thaliana (Mouse-ear cress) hypothetical 35.7 kda protein ,
arath-AT2G36290 Arabidopsis thaliana (Mouse-ear cress) at2g36290 protein ,
arath-AT2G44970 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein ,
arath-At3g52570 Arabidopsis thaliana (Mouse-ear cress) At3g52570/F22O6_50 hypothetical protein ,
arath-AT4g12830 Arabidopsis thaliana AT4g12830 hydrolase-like protein ,
arath-At5g21950 Arabidopsis thaliana DNA clone T6G21_60 At5g21950 BAC ,
arath-AT5G22460 Arabidopsis thaliana (Mouse-ear cress) gb|aaf31728.1 (hypothetical protein) ,
arath-AT5G39220 Arabidopsis thaliana (Mouse-ear cress) AT5G39220 seed-specific esterase regulator of tocopherol content AtVTE7 ,
arath-AT5G41120 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein ,
arath-At5g41130 Arabidopsis thaliana (Mouse-ear cress) At5g41130 gb|aac64874.1 ,
arath-At3g02030 Arabidopsis thaliana (Mouse-ear cress) F1C9.19 At3g02030 protein ,
arath-F1O17.3 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein (at1g74300) ,
arath-F1O17.4 Arabidopsis thaliana (Mouse-ear cress) At1g74290 hypothetical protein ,
arath-F1O17.5 Arabidopsis thaliana (Mouse-ear cress) hypothetical AT1G74280 42.3 kda protein ,
arath-F6D8.27 Arabidopsis thaliana gene F6D8.27 AT1G52510 on chromosome 1 epoxide hydrolase (EC 3.3.2.3) ,
arath-F9G14.280 Arabidopsis thaliana (Mouse-ear cress) AT5g02970 F9G14_280 hypothetical 58.4 kda protein ,
arath-F11F8.28 Arabidopsis thaliana (Mouse-ear cress) f11f8.28 AT3G09690 protein ,
arath-F14L2.60 Arabidopsis thaliana (Mouse-ear cress) At3g44510 hypothetical protein ,
arath-At3g54240 Arabidopsis thaliana (Mouse-ear cress) At3g54240 hypothetical 38.5 kda protein (fragment) ,
arath-At1g72620 Arabidopsis thaliana Putative uncharacterized protein F28P22_19 At1g72620 ,
arath-Q8LFU1 Arabidopsis thaliana (Mouse-ear cress) Putative hydrolase At4g39955 ,
arath-Q9FF27 Arabidopsis thaliana (Mouse-ear cress) Alpha/beta-Hydrolases superfamily protein chromosome 5, p1 clone:mxi10 At5g38360 ,
arath-Q6NL07 Arabidopsis thaliana (Mouse-ear cress) Alpha/beta-Hydrolases superfamily protein At1g13820 ,
arath-Q9LNR2 Arabidopsis thaliana (Mouse-ear cress) f1l3.12 At1g17430 ,
arath-Q9LR26 Arabidopsis thaliana (Mouse-ear cress) Alpha/beta-Hydrolases superfamily protein f26f24.20 At1g23330 ,
arath-Q9LVU7 Arabidopsis thaliana (Mouse-ear cress) At5g53050/MNB8_11 epoxide hydrolase (EC 3.3.2.3) ,
arath-Q9LW28 Arabidopsis thaliana (Mouse-ear cress) Genomic DNA, chromosome 3, P1 clone: MDJ14 At3g26820 ,
arath-At5g09430 Arabidopsis thaliana (Mouse-ear cress) Alpha/beta-Hydrolases superfamily protein ,
arath-AT4G10030 Arabidopsis thaliana (Mouse-ear cress) hypothetical 42.1 kda protein At4g10030 T5L19.160 ,
arath-At1g10740 Arabidopsis thaliana (Mouse-ear cress) Alpha/beta-Hydrolases superfamily protein At1g10740 T16B5.12 AtABH1 ,
arath-T17B22.7 Arabidopsis thaliana (Mouse-ear cress) At3g03240 t17b22.7 Alpha/beta-Hydrolases superfamily protein ,
arath-T17B22.8 Arabidopsis thaliana (Mouse-ear cress) t17b22.8/At3g03230 protein ,
arath-AXR4 Arabidopsis thaliana (Mouse-ear cress) At1g54990 T24C10.10 protein Protein AUXIN RESPONSE 4 ,
arath-At3g48410 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Alpha/beta-hydrolase domain-containing protein 43.4 kda At3g48410 T29H11.70 .
A85-EsteraseD-FGH :
arath-SFGH Arabidopsis thaliana (Mouse-ear cress) serine esterase s-formylglutathione hydrolase SFGH At2g41530 T32G6.5.
ABHD13-BEM46 :
arath-AT5G20520 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) ABAPT11 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase WAV2, WAVY GROWTH 2, Bem46-like protein .
ABHD17-depalmitoylase :
arath-AT1G66900 Arabidopsis thaliana (Mouse-ear cress) ABAPT7 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase ,
arath-AT2G24320 Arabidopsis thaliana (Mouse-ear cress) ABAPT9 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase at2g24320 ,
arath-AT4G31020 Arabidopsis thaliana (Mouse-ear cress) ABAPT8 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase AT4G31020 F6I18.70 ,
arath-AT5G38220 Arabidopsis thaliana (Mouse-ear cress) ABAPT2 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase ,
arath-F3C3.3 Arabidopsis thaliana (Mouse-ear cress) ABAPT10 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase AT1G32190/F3C3.3 ,
arath-AT1G13610 Arabidopsis thaliana (Mouse-ear cress) ABAPT6 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase f13b4.9 f21f23.4 AT1G13610 ,
arath-At5g14390 Arabidopsis thaliana (Mouse-ear cress) ABAPT3 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase At5g14390 ,
arath-F22K18.40 Arabidopsis thaliana (Mouse-ear cress) ABAPT1 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase. F22K18.40 At4g24760 ,
arath-At3g01690 Arabidopsis thaliana (Mouse-ear cress) ABAPT4 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase f28j7.1 at3g01690 ,
arath-Q9LI62 Arabidopsis thaliana (Mouse-ear cress) ABAPT5 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase At3g30380 .
ABHD18 :
arath-AT3G12150 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) . Putative uncharacterized protein .
abh_upf0017 :
arath-At3g50790 Arabidopsis thaliana (Mouse-ear cress) putative LEA protein At3g50790 ,
arath-At1g34340 Arabidopsis thaliana (Mouse-ear cress) protein, late embryogenesis abundant protein At1g34340 F23M19.1 ,
arath-Q9LTX5 Arabidopsis thaliana (Mouse-ear cress) At5g49950 K9P8.9 similarity to alpha/beta hydrolase .
Acidic_Lipase :
arath-AT1G73920 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) putative lipase ,
arath-At2g15230 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) F15A23.3 triacylglycerol lipase 1 precursor (EC 3.1.1.3) ,
arath-LIP2 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Triacylglycerol lipase 2 gene At5g1418 MUA22.18 MUA22.19 MYZUS PERSICAE-INDUCED LIPASE 1 ,
arath-Q8LPF5 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) f15h18.6 at1g18460/f15h18_15 .
ACPH_Peptidase_S9 :
arath-AARE Arabidopsis thaliana (Mouse-ear cress) acylamino acid-releasing enzymeAARE At4g14570 .
AlphaBeta_hydrolase :
arath-At2g19550 Arabidopsis thaliana (Mouse-ear cress) putative esterase ,
arath-AT4G14290 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein ,
arath-AT4G17150 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein ,
arath-AT5G19630 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein ,
arath-AT5G25770 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) hypothetical protein (at5g25770) ,
arath-C7A10.830 Arabidopsis thaliana DNA chromosome 4,gene C7A10.830 No. 2 AT4G36530 ,
arath-F1N18.12 Arabidopsis thaliana (Mouse-ear cress) f1n18.12 AT1G29840 protein ,
arath-F1P2.110 Arabidopsis thaliana (Mouse-ear cress). hypothetical protein f1p2.110 (at3g47560) ,
arath-F1P2.140 Arabidopsis thaliana (Mouse-ear cress). hypothetical protein F1P2.140 : AT3G47590 ,
arath-F14F18.80 Arabidopsis thaliana (Mouse-ear cress) putative esterase-like protein At5g11910 ,
arath-At5g38520 Arabidopsis thaliana At5g38520 MBB18.5 chromosome 5 ,
arath-Y3684 Arabidopsis thaliana (Mouse-ear cress) At3g26840 MDJ14.16 hypothetical protein ,
arath-Q8GYC0 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein At5g19850 T29J13_270 ,
arath-Q8L996 Arabidopsis thaliana (Mouse-ear cress) putative esterase-like protein ,
arath-Q6NKN2 Arabidopsis thaliana (Mouse-ear cress) Alpha/beta-Hydrolases superfamily protein At3g23540 MDB19 ,
arath-Y1457 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Acyltransferase-like protein, chloroplastic t22h22.2 At1g54570 PES1, phytyl ester synthase 1 .
BD-FAE :
arath-F14F8.240 Arabidopsis thaliana At5g15860(Mouse-ear cress) Isoprenylcysteine alpha-carbonyl methylesterase ICME ,
arath-F16B3.4 Arabidopsis thaliana (Mouse-ear cress) F16B3.4 At3g02410 Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2 ,
arath-ICML1 Arabidopsis thaliana At1g26120 F28B23.20 Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 .
Bodyguard :
arath-At5g41900 Arabidopsis thaliana; Arabidopsis lyrata subsp. lyrata K16L22.19 At5g41900 ,
arath-Q9FN74 Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein ,
arath-Q9FN79 Arabidopsis thaliana (Mouse-ear cress) Hydrolase, alpha/beta fold family protein At5g17720 MVA3.7 ,
arath-Q9SGU8 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata BODYGUARD At1g64670 F1N19.24 BDG1 ,
arath-T19F06.6 Arabidopsis thaliana (Mouse-ear cress) t19f06.6 At4g24140 T19F6_130 protein .
Carboxypeptidase_S10 :
arath-AT2G12480 Arabidopsis thaliana (Mouse-ear cress) putative serine carboxypeptidase II ,
arath-SCP51 Arabidopsis thaliana T1E2.16 SCP51 AT2G27920 (Mouse-ear cress) putative carboxypeptidase ,
arath-AT4G15100 Arabidopsis thaliana (Mouse-ear cress) SCP30 Putative serine carboxypeptidase-like 30 ,
arath-AT4g30610 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)putative serine carboxypeptidase II protein AT4g30610 ,
arath-SCP25 Arabidopsis thaliana (Mouse-ear cress) putative serine carboxypeptidase II SCPL25 AT3G02110 ,
arath-SCP29 Arabidopsis thaliana (Mouse-ear cress)SCPL29, F6I18.280, At4g30810 carboxypeptidase like protein ,
arath-F14D17.80 Arabidopsis thaliana At3g45010 (Mouse-ear cress) Arabidopsis lyrata (Lyre-leaved rock-cress)carboxypeptidase precursor-like protein ,
arath-SCP27 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) putative serine carboxypeptidase II At3g07990 ,
arath-SCP16 Arabidopsis thaliana (Mouse-ear cress) F28J15.15 At3g12220 F28J15.109 SCP16 serine carboxypeptidase ,
arath-SCP19 Arabidopsis thaliana Serine carboxypeptidase-like 19 MTH16.5 s ,
arath-Q9LVX9 Arabidopsis thaliana At5g36180 (Mouse-ear cress) serine carboxypeptidase ,
arath-SCP2 Arabidopsis thaliana T18K17_3 At1g73300 SCPL2 putative serine carboxypeptidase ,
arath-SCP4 Arabidopsis thaliana (Mouse-ear cress), T18K17_2 T9L24.47 At1g73310 SCP4 putative serine carboxypeptidase ,
arath-SCP5 Arabidopsis thaliana T18K17_4 At1g73290 SCPL5 putative serine carboxypeptidase ,
arath-SCP7 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At3g10450 SCPL7 F13M14.27 Serine carboxypeptidase-like 7 ,
arath-SCP8 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata(Lyre-leaved rock-cress) At2g22990 F21P24.5 SNG1 sinapoyltransferase (EC 2.3.1.92) ,
arath-SCP9 Arabidopsis thaliana (Mouse-ear cress) At2g23010 F21P24.7 SST SCPL9 SCP9 putative serine carboxypeptidase I ,
arath-SCP10 Arabidopsis thaliana (Mouse-ear cress) F21P24.6 putative serine carboxypeptidase I ,
arath-SCP11 Arabidopsis thaliana (Mouse-ear cress) SCP11 F21P24.3 At2g22970 putative serine carboxypeptidase I ,
arath-SCP12 Arabidopsis thaliana (Mouse-ear cress) SCP12 At2g22920 T20K9.13putative serine carboxypeptidase i ,
arath-SCP13 Arabidopsis thaliana (Mouse-ear cress) F21P24.4 T20K9.20 SCPL13 At2g22980 putative serine carboxypeptidase I ,
arath-SCP14 Arabidopsis thaliana F28J15.14 At3g12230 SCPL14 carboxypeptidase ,
arath-SCP15 Arabidopsis thaliana (Mouse-ear cress) SCPL15 At3g12240 F28J15.13 carboxypeptidase ,
arath-SCP17 Arabidopsis thaliana F28J15.16 At3g12203 SCPL17 carboxypeptidase ,
arath-SCP18 Arabidopsis thaliana (Mouse-ear cress) F10C21.18 At1g33540 serine carboxypeptidase-like 18 ,
arath-SCP20 Arabidopsis thaliana (Mouse-ear cress) At4g12910 F25G13.7 SCPL20 serine carboxypeptidase I precursor-like protein ,
arath-SCP21 Arabidopsis thaliana (Mouse-ear cress) SCPL21 At3g25420 MWL2.3 serine carboxypeptidase I ,
arath-SCP23 Arabidopsis thaliana (Mouse-ear cress) T29E15.21, SCPL23, At2g24010 putative serine carboxypeptidase ,
arath-SCP26 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), F11F19.31 AT2G35780 SCPL26, Serine carboxypeptidase-like 26 ,
arath-SCP28 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), SCP28 At2g35770, putative serine carboxypeptidase II ,
arath-SCP32 Arabidopsis thaliana (Mouse-ear cress) SCP32 F11P17.14 At1g61130 similar to serine carboxypeptidases ,
arath-SCP33 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) serine carboxypeptidase II-like protein At3g17180 ,
arath-SCP35 Arabidopsis thaliana (Mouse-ear cress) At5g08260 T22D6_200 SCPL35 serine-type carboxypeptidase II-like protein ,
arath-SCP36 Arabidopsis thaliana (Mouse-ear cress) F4F15.110 At3g52000 SCPL36 serine-type carboxypeptidase like protein ,
arath-SCP37 Arabidopsis thaliana (Mouse-ear cress) F4F15.120 At3g52010 serine-type carboxypeptidase like protein ,
arath-SCP39 Arabidopsis thaliana (Mouse-ear cress) F4F15.130 At3g52020 SCPL39 serine-type carboxypeptidase like protein ,
arath-SCP40 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) SCPL40 At3g63470 serine carboxypeptidase-like protein ,
arath-SCP41 Arabidopsis thaliana SCP41 K5J14.3 At5g42230 serine carboxypeptidase-II like ,
arath-SCP42 Arabidopsis thaliana K5J14.4 At5g42240 SCPL42 serine carboxypeptidase II-like ,
arath-SCP44 Arabidopsis thaliana (Mouse-ear cress), SCPL44, At1g43780, F28H19.5 putative serine carboxypeptidases ,
arath-SCP45 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata (Lyre-leaved rock-cress) F13K9.20 At1g28110 SCPL45 similar to serine carboxypeptidase II H.vulgare ,
arath-SCP46 Arabidopsis thaliana (Mouse-ear cress) SCPL46 F4P9.30 At2g33530 putative serine carboxypeptidase At2g33530 F4P9.30 ,
arath-SCP47 Arabidopsis thaliana MRN17.21 At5g22980 SCP47 serine carboxypeptidase ,
arath-SCP49 Arabidopsis thaliana SCP49 F13M14.32 At3g10410 SCPL49 carboxypeptidase Y-like protein ,
arath-SCPL6 Arabidopsis thaliana (Mouse-ear cress) T18K17.6, SCPL6, At1g73270, Serine carboxypeptidase-like 6 ,
arath-SCPL34 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), MKD15.7 At5g23210 serine carboxypeptidase II-like protein at5g23210 ,
arath-scp38 Arabidopsis thaliana (Mouse-ear cress) T6P5.5, SCPL38, At2g05850 Serine carboxypeptidase-like 38 ,
arath-SCP50 Arabidopsis thaliana (Mouse-ear cress) SCP50 At1g15000 t15d22.4 protein ,
arath-SCP3 Arabidopsis thaliana T18K17_5 Serine carboxypeptidase-like 3 SCPL3, At1g73280 ,
arath-SCP31 Arabidopsis thaliana (Mouse-ear cress) serine carboxypeptidase-like 31 SCPL31 At1g11080 T20D16.4 ,
arath-SCP22 Arabidopsis thaliana (Mouse-ear cress) Serine carboxypeptidase-like 22 SCPL22 At2g24000 .
CGI-58_ABHD5_ABHD4 :
arath-LPAAT Arabidopsis thaliana (Mouse-ear cress) 1-acylglycerol-3-phosphate O-acyltransferase t19f06.4 At4g24160 T19F6_150 .
Chlorophyllase :
arath-clh1 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) (chlase 1) (coronatine-induced protein 1) (cori1) AT1G19670 ,
arath-clh2 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) (chlorophyll-chlorophyllido hydrolase 2) (chlase 2) AT5G43860 .
CMBL :
arath-F12A4.4 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Carboxymethylenebutenolidase homolog .
Dienelactone_hydrolase :
arath-Q9LUG8 Arabidopsis thaliana (Mouse-ear cress)At3g23600 MDB19.8 similarity to endo-1,3-1,4-beta-D-glucanase ,
arath-Q9LUH1 Arabidopsis thaliana (Mouse-ear cress) similarity to endo-1,3-1,4-beta-D-glucanase At3g23560 MDB19.5 ,
arath-T26B15.8 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At2g32520 t26b15.8 putative carboxymethylenebutenolidaseprotein .
DPP4N_Peptidase_S9 :
arath-Q9FNF6 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) dipeptidyl peptidase IV-like protein At5g24260 MOP9.7 .
Duf_676 :
arath-At1g09980 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), hypothetical protein ,
arath-AT1G29120 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) hypothetical protein AT1G29120 ,
arath-AT4G25770 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AT4G25770/F14M19.50 hypothetical protein ,
arath-AT5G51180 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein ,
arath-At1g10040 Arabidopsis thaliana (Mouse-ear cress) Alpha/beta-hydrolases superfamily protein T27I1.6 At1g10040 ,
arath-ZW18 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) ZW18 protein (F19C14.4 protein) At1g58350 .
Duf_726 :
arath-o65513 Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein F23E13.100 At4g36210 ,
arath-q84w08 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Putative uncharacterized protein At2g18100 .
Duf_829 :
arath-q8s8g6 Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein Expressed protein (At2g18245) ,
arath-q8s8h8 Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein At2g15695 ,
arath-q9ffg7 Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein At5g44250; MLN1.18) ,
arath-q9lhe8 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MZE19 (At3g19970/MZE19_2) .
Duf_1350 :
arath-q9fij5 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata;Capsella rubella Uncharacterized protein AT5g47860/MCA23_20 ,
arath-q9m236 Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein T18D12_110 At3g43540 .
Duf_1749 :
arath-AT5G19050 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) hypothetical 38.4 kda protein protein at5g19050 .
Epoxide_hydrolase :
arath-At2g18360 Arabidopsis thaliana chromosome II clones T30D6, F24H14 At2g18360 ,
arath-At2g26740 Arabidopsis thaliana chromosome II (ATsEH) epoxide hydrolase At2g26740 auxin inducible ,
arath-At2g26750 Arabidopsis thaliana chromosome II clones T9J22, F18A8. At2g26750 ,
arath-C7A10.750 Arabidopsis thaliana DNA chromosome 4, ESSA I AP2 C7A10.750, At4g36610 ,
arath-dl4016c.1 Arabidopsis thaliana DNA chromosome 4,AT4G15960 dl4016c.1 ,
arath-F5I6.3 Arabidopsis thaliana F5I6_3 at1g80280 ,
arath-F9L1.44 Arabidopsis thaliana (Mouse-ear cress) F9L1.44 or AT1G15490 epoxide hydrolase (EC 3.3.2.3) ,
arath-F14G24.2 Arabidopsis thaliana At1g52750 F14G24_2 ,
arath-At3g05600 Arabidopsis thaliana (Mouse-ear cress) F18C1.13 At3g05600 epoxide hydrolase (EC 3.3.2.3) ,
arath-At3g51000 Arabidopsis thaliana F24M12.40 At3g51000 epoxide hydrolase-like protein ,
arath-T7M13.8 Arabidopsis thaliana (Mouse-ear cress) Putative alpha/beta hydrolase At3g10840 T7M13.8 ,
arath-T14P8.15 Arabidopsis thaliana (Mouse-ear cress) AT4g02340 protein BAC T14P8. T14P8.15 .
FSH1 :
arath-At1g09280 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata; Capsella rubella Q94AC1 At1g09280/T12M4.1 ,
arath-AT4G24380 Arabidopsis thaliana (Mouse-ear cress); Eutrema halophilum (Salt cress); Eutrema salsugineum (Saltwater cress) (Sisymbrium halophilum hypothetical protein; Capsella rubella ,
arath-Q9FKP9 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Alpha/beta-Hydrolases superfamily protein .
Glutamyl_Peptidase_S9 :
arath-CGEP Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress); Capsella rubella, At2g47390/T8I13.23 .
Hydroxynitrile_lyase :
arath-MES17 Arabidopsis thaliana AtMES17 MES17 T7M13.5 At3g10870 put. alpha-hydroxynitrile lyase ,
arath-AT4g09900 Arabidopsis thaliana AT4g09900 ,
arath-AT4G16690 Arabidopsis thaliana (Mouse-ear cress) cyanohydrin lyase homolog (cyanohydrin lyase like protein) Methylesterase 16 MES16 AtMES16,
arath-AT4G37150 Arabidopsis thaliana (Mouse-ear cress) AtMES9 arath-MES9 host response protein pir7a (hydroxynitrile lyase like protein) ,
arath-MES11 Arabidopsis thaliana (Mouse-ear cress) Putative methylesterase 11, chloroplastic AtMES11 MES11 At3g29770 ,
arath-HNL Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) HNL F18D22_70 at5g10300 alpha-hydroxynitrile lyase-like,
arath-MES15 Arabidopsis thaliana Putative methylesterase 15, chloroplastic AtMES15 MES15 RHS9 At1g69240 F4N2.19 F23O10.18 ,
arath-MES6 Arabidopsis thaliana (Mouse-ear cress) AtMES6 MES6 F26B6.20 At2g23550 putative host response protein (pir7) Putative acetone-cyanohydrin lyase ,
arath-MES7 Arabidopsis thaliana (Mouse-ear cress) AtMES7 MES7 Methylesterase 7 putative host response protein (pir7) F26B6.21 At2g23560 ,
arath-MES4 Arabidopsis thaliana (Mouse-ear cress) AtMES4 MES4 F26B6.23 At2g23580 putative acetone-cyanohydrin lyase ,
arath-MES8 Arabidopsis thaliana (Mouse-ear cress) AtMES8 Methylesterase 8, putative acetone-cyanohydrin lyase F26B6.24 At2g23590 ,
arath-MES2 Arabidopsis thaliana (Mouse-ear cress) AtMES2 MES2 F26B6.25 putative acetone-cyanohydrin lyase ,
arath-MES1 Arabidopsis thaliana Methylesterase 1, AtMES1 AT2G23620 F26B6.27 putative acetone-cyanohydrin lyase ,
arath-MES18 Arabidopsis thaliana Methylesterase 18 AtMES18 MES18 MCK7.18 polyneuridine aldehyde esterase-like protein ,
arath-F4IE65 Arabidopsis thaliana Putative methylesterase 13, chloroplastic T1K7.26 At1g26360 ,
arath-MES14 Arabidopsis thaliana, Arabidopsis lyrata, AtMES14 MES14 At1g33990 T15K4.4 F12G12.19, F12G12.220, polyneuridine aldehyde esterase putative ,
arath-MES10 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Methylesterase 10 AtMES10 MES10 T20E23.40 AT3g50440 ,
arath-MES19 Arabidopsis thaliana (Mouse-ear cress) AtMES19 AT2G23570 Putative methylesterase 19 .
LIDHydrolase :
arath-T19F11.2 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) t19f11.2 At3g11620 protein .
Lipase_3 :
arath-At1g05790 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) t20m3.5 At1g05790 protein ,
arath-AT2G05260 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) at2g05260 protein ,
arath-At2g42450 Arabidopsis thaliana At2g42450 MHK10.17 ,
arath-At3g61680 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At3g61680 F15G16.70 PLIP1 Phospholipase A1, chloroplastic ,
arath-AT3g62590 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), AT3g62590 F26K9_20 hypothetical 69.4 kda protein ,
arath-AT4G00500 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) F6N23.21 AT4G00500 lipase protein ,
arath-AT4G16070 Arabidopsis thaliana (Mouse-ear cress) dna chromosome 4, essaIcontig fragment no. 5 ,
arath-at5g18630 Arabidopsis thaliana (Mouse-ear cress) at5g18630/t1a4_10 ,
arath-At5g24180 Arabidopsis thaliana (Mouse-ear cress) At5g24180 gb|aad29063.1 ,
arath-AT5G24190 Arabidopsis thaliana (Mouse-ear cress) AT5G24190 gb|aad29063.1 ,
arath-At5g24200 Arabidopsis thaliana (Mouse-ear cress) gb|aad29063.1 ,
arath-AT5G24210 Arabidopsis thaliana (Mouse-ear cress) gb|aad29063.1 (hypothetical 39.4 kda protein) ,
arath-At5g24220 Arabidopsis thaliana (Mouse-ear cress)At5g24220 gb|aad29063.1 ,
arath-AT5G24230 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein (at5g24230) ,
arath-At5g37710 Arabidopsis thaliana (Mouse-ear cress)At5g37710 calmodulin-binding heat-shock protein ,
arath-GDL62 Arabidopsis thaliana (Mouse-ear cress) At4g10955 f8m12.9 F25I24.160 hypothetical 74.6 kda protein ,
arath-q3e9e4 Arabidopsis thaliana (Mouse-ear cress) protein At5g18640 ,
arath-Q9FI59 Arabidopsis thaliana (Mouse-ear cress) Lipase domain-containing protei gb|aad29063.1 At5g50890 K3K7.3 ,
arath-Q9LJI1 Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein AT3g14070/MAG2_2 in fact At3g14075 ,
arath-At3g49050 Arabidopsis thaliana (Mouse-ear cress) At3g49050 Alpha/beta-Hydrolases superfamily protein ,
arath-T14P4.6 Arabidopsis thaliana chromosome gene T14P4.6 At1g02660 PLIP2 PLASTID LIPASE 2 .
LYsophospholipase_carboxylesterase :
arath-AT1G52695 Arabidopsis thaliana (Mouse-ear cress) AT1G52695 f6d8.8 protein ,
arath-SOBR1 Arabidopsis thaliana AtSOBER1 AT4G22305 gene, chromosome 4 locus:6530298215,
arath-SOBRL Arabidopsis thaliana SOBRL SOBER1-like AtTIPSY1 AT4g22300 gene, chromosome 4 ,
arath-AT5G20060 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) putative lysophospholipase (hypothetical protein) ,
arath-At1g52700 Arabidopsis thaliana (Mouse-ear cress) f6d8.5 At1g52700 ,
arath-F6D8.31 Arabidopsis thaliana (Mouse-ear cress) f6d8.31 AT1G52470 ,
arath-F6D8.32 Arabidopsis thaliana (Mouse-ear cress) f6d8.32 AT1G52460 protein ,
arath-F6D8.34 Arabidopsis thaliana (Mouse-ear cress) f6d8.34 AT1G52440 protein ,
arath-Q9LW14 Arabidopsis thaliana (Mouse-ear cress) lysophospholipase-like protein At3g15650 .
Maspardin-ACP33-SPG21_like :
arath-At4g12230 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Alpha/beta-Hydrolases superfamily protein At4g12230 T4C9.70 .
MenH_SHCHC :
arath-T6L1.8 Arabidopsis thaliana (Mouse-ear cress) At1g68900 Protein PHYLLO, chloroplastic last domain .
Monoglyceridelipase_lysophospholip :
arath-At1g18360 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AtMAGL2 at1g18360 / f15h18_2 Alpha/beta-hydrolase domain-containing protein ,
arath-At2g47630 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AtMAGL9 at2g47630/f17a22.2 ,
arath-At5g11650 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), AtMAGL13, T22P22.40, At5g11650, lysophospholipase-like protein ,
arath-At5g16120 Arabidopsis thaliana (Mouse-ear cress) AtMAGL15 T21H19_40 At5g16120 lipase-like protein ,
arath-AT5G19290 Arabidopsis thaliana (Mouse-ear cress) AtMAGL16 putative phospholipase ,
arath-F2G14.100 Arabidopsis thaliana (Mouse-ear cress) AtMAGL14 AT5G14980 lysophospholipase-like protein ,
arath-F12L6.6 Arabidopsis thaliana (Mouse-ear cress) At2g39400/F12L6.6 putative lysophospholipase ,
arath-F12L6.7 Arabidopsis thaliana (Mouse-ear cress) AtMAGL7 putative lysophospholipase cdna: ceres:124576 ,
arath-F12L6.8 Arabidopsis thaliana (Mouse-ear cress) AtMAGL8 putative lysophospholipase ,
arath-F14G24.3 Arabidopsis thaliana (Mouse-ear cress) AtMAGL3 Caffeoyl shikimate esterase F14G24.3/AT1G52760 ,
arath-T5M16.2 Arabidopsis thaliana (Mouse-ear cress) AtMAGL5 T5M16_2 At1g77420 putative lipase ,
arath-T9L24.33 Arabidopsis thaliana (Mouse-ear cress) AtMAGL4 lysophospholipase homolog, putative At1g73480 T9L24.33 ,
arath-T19D16.3 Arabidopsis thaliana (Mouse-ear cress) AtMAGL1 At1g11090/T19D16_3 lysophospholipase isolog ,
arath-T26I12.60 Arabidopsis thaliana (Mouse-ear cress) AtMAGL10 lipase-like protein At3g55180 T26I12.60 ,
arath-T26I12.70 Arabidopsis thaliana (Mouse-ear cress) AtMAGL11 lipase-like protein At3g55190 .
Ndr_family :
arath-At2g19620 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) NDL3 putative sf21 protein (helianthus annuus) ,
arath-At5g56750 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) NDL1 pollen specific protein sf21 (At5g56750/MIK19_22) ,
arath-At5g11790 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) hypothetical 40.2 kda protein At5g11790, T22P22_180 NDL2 .
NLS3-Tex30 :
arath-Q9FJ29 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At5g41850 Alpha/beta-Hydrolases superfamily protein .
Palmitoyl-protein_thioesterase :
arath-AT4G17470 Arabidopsis thaliana (Mouse-ear cress) thioesterase homolog (thioesterase like protein) ,
arath-AT4G17480 Arabidopsis thaliana (Mouse-ear cress) thioesterase homolog (thioesterase like protein) ,
arath-AT4G17483 Arabidopsis thaliana (Mouse-ear cress) hypothetical protein at4g17483 ,
arath-At5g47330 Arabidopsis thaliana (Mouse-ear cress) At5g47330 Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) palmitoyl-protein thioesterase precursor-like ,
arath-At3g60340 Arabidopsis thaliana (Mouse-ear cress) palmitoyl-protein thioesterase precursor-like At3g60340 F27H5_130 ,
arath-Q9LVS4 Arabidopsis thaliana (Mouse-ear cress) palmitoyl-protein thioesterase precursor-like At5g47350 MQL5.21 ,
arath-Q9LVS5 Arabidopsis thaliana (Mouse-ear cress) palmitoyl-protein thioesterase precursor-like At5g47340 .
PC-sterol_acyltransferase :
arath-At5g13640 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) at5g13640/msh12_10 Phospholipid:diacylglycerol acyltransferase 1 PDAT1 ,
arath-LCAT2 Arabidopsis thaliana (Mouse-ear cress) At1g04010 f21m11.5 Phospholipid--sterol O-acyltransferase PSAT ,
arath-PDAT2 Arabidopsis thaliana (Mouse-ear cress) At3g44830 PDAT2 Putative phospholipid:diacylglycerol acyltransferase 2 ,
arath-LCAT1 Arabidopsis thaliana (Mouse-ear cress) f17l21.27 (at1g27480/f17l21_28) ,
arath-LCAT4 Arabidopsis thaliana (Mouse-ear cress) Lecithin-cholesterol acyltransferase-like 4 ,
arath-LCAT3 Arabidopsis thaliana (Mouse-ear cress) Phospholipase A(1) LCAT3 At3g03310 t21p5.27 .
Pectinacetylesterase-Notum :
arath-o65713 Arabidopsis thaliana (Mouse-ear cress) Putative pectinacetylesterase AT4g19420 AtPAE8 ,
arath-o80731 Arabidopsis thaliana (Mouse-ear cress) Putative pectinesterase At2g46930/F14M4.24 AtPAE3 ,
arath-q8lae9 Arabidopsis thaliana (Mouse-ear cress) Pectin acetylesterase AtPAE11 ,
arath-Q84JS1 Arabidopsis thaliana (Mouse-ear cress) Pectinacetylesterase-like protein AtPAE6 ,
arath-Q9SFF6 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Arabis alpina (Alpine rock-cress) Putative pectinacetylesterase At3g05910/F2O10_3 AtPAE12 ,
arath-q9sr22 Arabidopsis thaliana (Mouse-ear cress) Putative pectinacetylesterase At3g09410 AtPAE5 ,
arath-q9sr23 Arabidopsis thaliana (Mouse-ear cress) Putative pectinacetylesterase At3g09405 AtPAE4 ,
arath-q66gm8 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) subsp. petraea (Northern rock-cress) (Cardaminopsis petraea) At5g26670 F21E10.11 AtPAE10 ,
arath-f4jt64 Arabidopsis thaliana (Mouse-ear cress).AT4g19410 Pectinacetylesterase family protein AtPAE7 ,
arath-B9DFR3 Arabidopsis thaliana (Mouse-ear cress). Pectin acetylesterase 9 AtPAE9 ,
arath-pae2 Arabidopsis thaliana (Mouse-ear cress). Pectin acetylesterase 2 At1g57590/T8L23_6 AtPAE2 ,
arath-pae1 Arabidopsis thaliana (Mouse-ear cress). Pectin acetylesterase 1 AtPAE1 .
PGAP1 :
arath-At3g27325 Arabidopsis thaliana (Mouse-ear cress) At3g27325 similarity to negative regulator of vesicle formation ,
arath-At5g17670 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) MVA3.2, At5g17670 Hydrolase-like protein .
Pheophytinase :
arath-Q9FFZ1 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) PPH, non yellow coloring 3, At5g13800, Pheophytinase, chloroplastic CRN1 .
Plant_carboxylesterase :
arath-At2g45610 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AtCXE9 At2g45610 F17K2.14, chromosome II ,
arath-AT2G03550 Arabidopsis thaliana (Mouse-ear cress) AtCXE7 putative esterase T4M8.1 at2g03550 ,
arath-AT5G27320 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Probable gibberellin receptor GID1L3 GID1-like protein 3 AtCXE19 AT5G27320 F21A20.30 ,
arath-AT5G62180 Arabidopsis thaliana carboxylesterase 20 AtCXE20 AT5G62180 ,
arath-CXE12 Arabidopsis thaliana (Mouse-ear cress) AtCXE12 AT3g48690 T8P19.200 ,
arath-CXE15 Arabidopsis thaliana (Mouse-ear cress) AtCXE15 At5g06570 F15M7.10 chromosome 5 ,
arath-F1N13.220 Arabidopsis thaliana; Arabidopsis lyrata AtCXE17 At5g16080 F1N13.220 chromosome 5 ,
arath-F14J22.11 Arabidopsis thaliana (Mouse-ear cress) AtCXE5 AT1G49660 f14j22.11 protein ,
arath-F14J22.12 Arabidopsis thaliana (Mouse-ear cress) AtCXE3 At1g49640 f14j22.12 protein ,
arath-F16N3.25 Arabidopsis thaliana AtCXE2 At1g47480 F16N3.25 ,
arath-CXE8 Arabidopsis thaliana AtCXE8 At2g45600 f17k2_13 chromosome II ,
arath-At5g14310 Arabidopsis thaliana (Mouse-ear cress) AtCXE16 At5g14310 F18O22_100 hypothetical 48.6 kda protein ,
arath-CXE6 Arabidopsis thaliana AtCXE6 F24J5.14 At1g68620 Putative carboxylesterase ,
arath-gid1 Arabidopsis thaliana Probable gibberellin receptor GID1L1 GID1-like protein 1 AtCXE10 At3g05120 T12H1.8 chromosome III,
arath-GID1B Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Probable gibberellin receptor GID1L2 GID1-like protein 2 GA INSENSITIVE DWARF 1B AtCXE14 At3g63010 T20O10_110 ,
arath-CXE11 Arabidopsis thaliana AtCXE11 K17E12.14 F12K2.10 At3g27320 chromosome 3 ,
arath-CXE18 Arabidopsis thaliana Probable carboxylesterase 18 AtCXE18 MQM1.21 At5g23530 ,
arath-Q8LF34 Arabidopsis thaliana (Mouse-ear cress) AtCXE4 At1g49650 F14J22.6 putative esterase ,
arath-CXE13 Arabidopsis thaliana (Mouse-ear cress) AtCXE13 T8P19.210 At3g48700 Probable carboxylesterase 13 CXE13 PrMC3 ,
arath-CXE1 Arabidopsis thaliana (Mouse-ear cress) Probable carboxylesterase 1 AtCXE1 T29M8.6 At1g19190 .
Plant_lipase_EDS1-like :
arath-At5g14930 Arabidopsis thaliana (Mouse-ear cress) At5g14930 sag101 AtSAG101,
arath-eds1 Arabidopsis thaliana lipase homolog (EDS1) (Enhanced disease susceptibility 1-like) At3g48090 AtEDS1,
arath-PAD4 Arabidopsis thaliana (Mouse-ear cress) PAD4 lipase 61.0 kda protein EDS9 At3g52430 AtPAD4,
arath-T17F15.50 Arabidopsis thaliana (Mouse-ear cress) =Enhanced disease susceptibility 1 protein B EDS1B At3g48080/T17F15_50 .
Plant_phospholipase :
arath-AT2G42690 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) putative lipase ,
arath-AT4G16820 Arabidopsis thaliana (Mouse-ear cress) (Triacylglycerol lipase like protein) ,
arath-At4g18550 Arabidopsis thaliana (Mouse-ear cress) DSEL Phospholipase A1-IIgamma lipase-like protein,
arath-F9P14.11 Arabidopsis thaliana (Mouse-ear cress) f9p14.11 protein ,
arath-PLA11 Arabidopsis thaliana (Mouse-ear cress)Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) T13E15.18 At2g44810 DAD1 DEFECTIVE IN ANTHER DEHISCENCE1 triacyglycerol lipase isolog ,
arath-PLA12 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) t20m3.6 protein At1g05800 ,
arath-PLA13 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) PLA13 At2g31690 in clone T9H9 ,
arath-PLA15 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At1g06800 F4H5_10, PLA15, DAD1-Like Lipase 4, DALL4 Phospholipase A1-Igamma1, chloroplastic ,
arath-PLA16 Arabidopsis thaliana (Mouse-ear cress) PLA16 T06B20.10 At2g30550 lipase isolog DAD1-Like Lipase 3, DALL3 ,
arath-PLA17 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), PLA17 At1g51440 F5D21.19 hypothetical 60.3 kda protein ,
arath-PLA19 Arabidopsis thaliana (Mouse-ear cress) T16B12.9, At2g31100, PLA19 putative lipase ,
arath-At1g30370 Arabidopsis thaliana (Mouse-ear cress) DAD1-like acylhydrolase lipase, putative At1g30370 T4K22.3 .
PMH_Peptidase_S9 :
arath-Q9FG66 Arabidopsis thaliana (Mouse-ear cress) acyl-peptide hydrolase-like At5g36210 T30G6.2 .
PPase_methylesterase_euk :
arath-T5L19.180 Arabidopsis thaliana (Mouse-ear cress) lipase-like protein At4g10050 T5L19.180 .
Proline_iminopeptidase :
arath-at3g61540 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) prolyl aminopeptidase-like protein (at3g61540/f2a19_140) ,
arath-pip Arabidopsis thaliana, Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) proline iminopeptidase T1O16.15 At2g14260 .
Prolylcarboxypeptidase :
arath-a4vcl8 Arabidopsis thaliana (Mouse-ear cress) Serine carboxypeptidase S28 family protein At4g36190 F23E13_80 ,
arath-At2g24280 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At2g24280/f27d4.19 ,
arath-AT4G36195 Arabidopsis thaliana (Mouse-ear cress) hypothetical 54.8 kda protein ,
arath-F6H11.120 Arabidopsis thaliana (Mouse-ear cress) At5g65760 lysosomal pro-x carboxypeptidase - like protein ,
arath-Q8LFB7 Arabidopsis thaliana (Mouse-ear cress) prolylcarboxypeptidase-like protein At5g22860 .
RsbQ-like :
arath-AtD14 Arabidopsis thaliana (Mouse-ear cress) t11i18.10 protein (At3g03990/T11I18.10) AtD14 DWARF14,
arath-KAI2.D14L Arabidopsis thaliana (Mouse-ear cress) At4g37470 KAI2 AtKAI2 HTL hyposensitive to light,
arath-Q9LK01 Arabidopsis thaliana (Mouse-ear cress) hydrolase-like protein At3g24420 DWARF14-LIKE2 (DLK2) .
S9N_PPCE_Peptidase_S9 :
arath-AT1G76140 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) AT1G76140 t23e18.8 ,
arath-F14O10.2 Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), AT1G20380 f14o10.2 protein .
S9N_PREPL_Peptidase_S9 :
arath-F14I3.4 Arabidopsis thaliana (Mouse-ear cress) At1g50380 f14i3.4 protein ,
arath-Q9FGD4 Arabidopsis thaliana (Mouse-ear cress) Prolyl oligopeptidase family protein K8A10.3 At5g66960 ,
arath-T6L1.20 Arabidopsis thaliana (Mouse-ear cress) putative protease T6L1.20 At1g69020 .
Triacylglycerol-lipase-OBL1-like :
arath-At3g14360 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata Oil body lipase 1 AtOBL1: TAG, DAG and 1-MAG lipase ,
arath-At5g42930 Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At5g42930 chromosome 5, p1 clone:mbd2 ,
arath-At5g67050 Arabidopsis thaliana (Mouse-ear cress) At5g67050 k21h1_1 ,
arath-At1g56630 Arabidopsis thaliana (Mouse-ear cress) f25p12.93 protein At1g56630 ? ,
arath-Q8L7S1 Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata At1g45200 TLL1 ,
arath-a0a1p8bcz0 Arabidopsis thaliana (Mouse-ear cress). Alpha/beta-Hydrolases superfamily protein .
UCP031088 :
arath-At1g73750 Arabidopsis thaliana (Mouse-ear cress) At1g73750/F25P22.17 ,
arath-At1g15070 Arabidopsis thaliana (Mouse-ear cress) At1g15070/f9l1_1 ,
arath-a0a1p8awg3 Arabidopsis thaliana (Mouse-ear cress). Alpha/beta hydrolase family protein Molecular evidence
Database
No mutation No structure No kinetic
Sequence
Graphical view for this peptide sequence: arath-MES3 Colored MSA for Hydroxynitrile_lyase (raw)
MSEEERKQHVVLVHGACHGAWCWYKVKPQLEASGHRVTAVDLAASGIDMT
RSITDISTCEQYSEPLMQLMTSLPDDEKVVLVGHSLGGLSLAMAMDMFPT
KISVSVFVTAMMPDTKHSPSFVWDKLRKETSREEWLDTVFTSEKPDFPSE
FWIFGPEFMAKNLYQLSPVQDLELAKMLVRANPLIKKDMAERRSFSEEGY
GSVTRIFIVCGKDLVSPEDYQRSMISNFPPKEVMEIKDADHMPMFSKPQQ
LCALLLEIANKYA
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
M S E E E R K Q H V V L V H G A C H G A W C W Y K V K P Q L E A S G H R V T A V D L A A S G I D M T R S I T D I S T C E Q Y S E P L M Q L M T S L P D D E K V V L V G H S L G G L S L A M A M D M F P T K I S V S V F V T A M M P D T K H S P S F V W D K L R K E T S R E E W L D T V F T S E K P D F P S E F W I F G P E F M A K N L Y Q L S P V Q D L E L A K M L V R A N P L I K K D M A E R R S F S E E G Y G S V T R I F I V C G K D L V S P E D Y Q R S M I S N F P P K E V M E I K D A D H M P M F S K P Q Q L C A L L L E I A N K Y A no DNA
Reference
Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
Lin X , Kaul S , Rounsley S , Shea TP , Benito MI , Town CD , Fujii CY , Mason T , Bowman CL and Venter JC <27 more author(s)>
Lin X , Kaul S , Rounsley S , Shea TP , Benito MI , Town CD , Fujii CY , Mason T , Bowman CL , Barnstead M , Feldblyum TV , Buell CR , Ketchum KA , Lee J , Ronning CM , Koo HL , Moffat KS , Cronin LA , Shen M , Pai G , Van Aken S , Umayam L , Tallon LJ , Gill JE , Adams MD , Carrera AJ , Creasy TH , Goodman HM , Somerville CR , Copenhaver GP , Preuss D , Nierman WC , White O , Eisen JA , Salzberg SL , Fraser CM , Venter JC (- 27)
Ref: Nature, 402 :761, 1999 : PubMed Abstract ESTHER: Lin_1999_Nature_402_761 PubMedSearch: Lin 1999 Nature 402 761 PubMedID: 10617197 Gene_locus related to this paper: arath-At2g45610 ,
arath-AT2G03550 ,
arath-AT2G05260 ,
arath-AT2G12480 ,
arath-At2g15230 ,
arath-At2g18360 ,
arath-At2g19550 ,
arath-At2g19620 ,
arath-At2g24280 ,
arath-AT2G24320 ,
arath-At2g26740 ,
arath-At2g26750 ,
arath-SCP51 ,
arath-AT2G36290 ,
arath-At2g42450 ,
arath-AT2G42690 ,
arath-AT2G44970 ,
arath-At2g47630 ,
arath-AT3g62590 ,
arath-CGEP ,
arath-F12L6.6 ,
arath-F12L6.7 ,
arath-F12L6.8 ,
arath-At3g50790 ,
arath-MES6 ,
arath-MES7 ,
arath-MES4 ,
arath-MES8 ,
arath-MES2 ,
arath-MES3 ,
arath-MES1 ,
arath-o80731 ,
arath-pip ,
arath-PLA11 ,
arath-PLA13 ,
arath-PLA16 ,
arath-PLA19 ,
arath-q84w08 ,
arath-SCP8 ,
arath-SCP9 ,
arath-SCP10 ,
arath-SCP11 ,
arath-SCP12 ,
arath-SCP13 ,
arath-SCP23 ,
arath-SCP26 ,
arath-SCP28 ,
arath-SCP46 ,
arath-T26B15.8 ,
arath-SCP22 ,
arath-SFGH ,
arath-MES19 Abstract
Arabidopsis thaliana (Arabidopsis) is unique among plant model organisms in having a small genome (130-140 Mb), excellent physical and genetic maps, and little repetitive DNA. Here we report the sequence of chromosome 2 from the Columbia ecotype in two gap-free assemblies (contigs) of 3.6 and 16 megabases (Mb). The latter represents the longest published stretch of uninterrupted DNA sequence assembled from any organism to date. Chromosome 2 represents 15% of the genome and encodes 4,037 genes, 49% of which have no predicted function. Roughly 250 tandem gene duplications were found in addition to large-scale duplications of about 0.5 and 4.5 Mb between chromosomes 2 and 1 and between chromosomes 2 and 4, respectively. Sequencing of nearly 2 Mb within the genetically defined centromere revealed a low density of recognizable genes, and a high density and diverse range of vestigial and presumably inactive mobile elements. More unexpected is what appears to be a recent insertion of a continuous stretch of 75% of the mitochondrial genome into chromosome 2.
         Other Papers