arath-MES4

 
Arabidopsis thaliana (Mouse-ear cress) AtMES4 MES4 F26B6.23 At2g23580 putative acetone-cyanohydrin lyase

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Methyl-salicylate ,

2 Genbank : AC003040, CP002685
2 UniProt : O80474, F4IMK6
2 UniProtTrembl : O80474, F4IMK6
2 Interpro : O80474, F4IMK6
2 Prodom : O80474, F4IMK6
2 Pfam : O80474, F4IMK6
2 PIRSF : O80474, F4IMK6
2 SUPERFAM : O80474, F4IMK6
2 QuickSwissBlast : O80474, F4IMK6
1 Tair database : At2g23580
 
Sequence
Graphical view for this peptide sequence: arath-MES4
Colored MSA for Hydroxynitrile_lyase (raw)
MEKNNKKRFVLVHGLCHGAWCWYKVKTHLEAVGHCVTAVDLAASGINMTR
LEEIQTLKDYCKPLLELLNSLGSDDDKVILVAHSMGGIPAALASDIFPSK
IATIVFLTAFMPDTRNLPAYVYQKLIRSVPQEGWLDTVFGTYGKHECPLE
FALFGPKFMAKNLYQLSPVQDLELAKMLVRVNPIITNNLAGTRSFSEEGY
GTVTRIYIVCGEDMAVPEDYQWWMIKNFPPKEVMEIKCADHMAMFSKPHK
LCALLVEIACKYA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKNNKKRFVLVHGLCHGAWCWYKVKTHLEAVGHCVTAVDLAASGINMTR
LEEIQTLKDYCKPLLELLNSLGSDDDKVILVAHSMGGIPAALASDIFPSK
IATIVFLTAFMPDTRNLPAYVYQKLIRSVPQEGWLDTVFGTYGKHECPLE
FALFGPKFMAKNLYQLSPVQDLELAKMLVRVNPIITNNLAGTRSFSEEGY
GTVTRIYIVCGEDMAVPEDYQWWMIKNFPPKEVMEIKCADHMAMFSKPHK
LCALLVEIACKYA

no DNA




Reference
    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer