arath-MES6

 
Arabidopsis thaliana (Mouse-ear cress) AtMES6 MES6 F26B6.20 At2g23550 putative host response protein (pir7) Putative acetone-cyanohydrin lyase

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AC003040, BT004125, CP002685
1 UniProt : F4IMK2
1 UniProtTrembl : F4IMK2
1 Interpro : F4IMK2
1 Prodom : F4IMK2
1 Pfam : F4IMK2
1 PIRSF : F4IMK2
1 SUPERFAM : F4IMK2
1 QuickSwissBlast : F4IMK2
1 Tair database : At2g23550
 
Sequence
Graphical view for this peptide sequence: arath-MES6
Colored MSA for Hydroxynitrile_lyase (raw)
MLRVRKAMENKNQKRFVLIHGVCHGAWTWDKVKTQLEVAGHCVTAVDLAA
SGINMTKVEEIQTLNDYCKPLLEFLSSLGSDDGKVIVVAHSMGGISAALA
ADSFACKIAAIVFLTAFMPDTINPPAYVYEKLLRSIPQEEWLDTTCVNYG
KPDFPLQYTLLGPKFMAKKMYQNSPVQDLEVVKTLVRENPLVTNNLAGTR
SFSEEGYGSVTRIYIVCREDLVEVEDYQRWMISNFPPKEVMEIKCADHMP
MFSKPQEVCALLLEIANKYCKN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRVRKAMENKNQKRFVLIHGVCHGAWTWDKVKTQLEVAGHCVTAVDLAA
SGINMTKVEEIQTLNDYCKPLLEFLSSLGSDDGKVIVVAHSMGGISAALA
ADSFACKIAAIVFLTAFMPDTINPPAYVYEKLLRSIPQEEWLDTTCVNYG
KPDFPLQYTLLGPKFMAKKMYQNSPVQDLEVVKTLVRENPLVTNNLAGTR
SFSEEGYGSVTRIYIVCREDLVEVEDYQRWMISNFPPKEVMEIKCADHMP
MFSKPQEVCALLLEIANKYCKN

no DNA




References
    Title: Inactive methyl indole-3-acetic acid ester can be hydrolyzed and activated by several esterases belonging to the AtMES esterase family of Arabidopsis
    Yang Y, Xu R, Ma CJ, Vlot AC, Klessig DF, Pichersky E
    Ref: Plant Physiol, 147:1034, 2008 : PubMed

            

    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer