arath-PLA15

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) At1g06800 F4H5_10, PLA15, DAD1-Like Lipase 4, DALL4 Phospholipase A1-Igamma1, chloroplastic

Comment
Warning Q9M9Y7 is called F4H5.11 gene but this seems to be wrong


Relationship
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: AY052199, AC011001, CP002684
3 UniProt : Q941F1, D7KG67, F4HNT5
>3 UniProtTrembl links 1 more: F4HNT5, A0A178WG46, Q941F1
>3 Interpro links 1 more: F4HNT5, A0A178WG46, Q941F1
>3 Prodom links 1 more: F4HNT5, A0A178WG46, Q941F1
>3 Pfam links 1 more: F4HNT5, A0A178WG46, Q941F1
>3 PIRSF links 1 more: F4HNT5, A0A178WG46, Q941F1
>3 SUPERFAM links 1 more: F4HNT5, A0A178WG46, Q941F1
>3 QuickSwissBlast links 1 more: F4HNT5, A0A178WG46, Q941F1
1 Tair database : At1g06800
 
Sequence
Graphical view for this peptide sequence: arath-PLA15
Colored MSA for Plant_phospholipase (raw)
MATIPSHNLRPHTTNQRTQYSLSFRPHFSRSTLITFPARSSPARAMSRTD
EEASISTRLEQESYGLTTAEDIRRRDGEAKESKRLRDTWRKIQGEDDWAG
LMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTRRHLFDSL
GIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDN
EATRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPAVKA
ESGFLDLYTDKDTSCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVT
GHSLGGALAVLSAYDVAEMGVNRTRKGKVIPVTAFTYGGPRVGNIRFKER
IEKLGVKVLRVVNEHDVVAKSPGLFLNERAPQALMKLAGGLPWCYSHVGE
MLPLDHQKSPFLKPTVDLSTAHNLEALLHLLDGYHGKGQRFVLSSGRDPA
LVNKASDFLKDHFMVPPYWRQDANKGMVRNTDGRWIQPDRIRADDQHAPD
IHQLLTQLHHPSQLL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATIPSHNLRPHTTNQRTQYSLSFRPHFSRSTLITFPARSSPARAMSRTD
EEASISTRLEQESYGLTTAEDIRRRDGEAKESKRLRDTWRKIQGEDDWAG
LMDPMDPVLRSELIRYGEMAQACYDAFDFDPFSRYCGSCRFTRRHLFDSL
GIIDSGYEVARYLYATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDN
EATRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNGFRCPDPAVKA
ESGFLDLYTDKDTSCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVT
GHSLGGALAVLSAYDVAEMGVNRTRKGKVIPVTAFTYGGPRVGNIRFKER
IEKLGVKVLRVVNEHDVVAKSPGLFLNERAPQALMKLAGGLPWCYSHVGE
MLPLDHQKSPFLKPTVDLSTAHNLEALLHLLDGYHGKGQRFVLSSGRDPA
LVNKASDFLKDHFMVPPYWRQDANKGMVRNTDGRWIQPDRIRADDQHAPD
IHQLLTQLHHPSQLL

no DNA




References
4 more
    Title: Phospholipid-derived signaling mediated by phospholipase A in plants
    Ryu SB
    Ref: Trends Plant Sci, 9:229, 2004 : PubMed

            

    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer