Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-Q9FFZ1

Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) PPH, non yellow coloring 3, At5g13800, Pheophytinase, chloroplastic CRN1

Comment
Other strains:Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). Pheophytinase PPH Stay-green gene CRN1 (Co-regulated with NYE1)


Relationship
Family|Pheophytinase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Phaeophytin
No inhibitor
2 Genbank : AB005230, GL348718
1 UniProt : D7M5W5
2 UniProt : Q9FFZ1, D7M5W5
2 Interpro : Q9FFZ1, D7M5W5
2 Prodom : Q9FFZ1, D7M5W5
2 Pfam : Q9FFZ1, D7M5W5
2 PIRSF : Q9FFZ1, D7M5W5
2 SUPERFAM : Q9FFZ1, D7M5W5
1 Tair database : At5g13800
Sequence
Graphical view for this peptide sequence: arath-Q9FFZ1
Colored MSA for Pheophytinase (raw)
MEIISLNVVPQCSVVTWSSKLATKRLVPNRSSLLFSGVKKSRLVIRSGNS
DGYVVGENDDLGRIARRGESTSKVLIPGLPDESNGEIAARISHSHCEWKP
KLRVHYEKAGCDNLDAPAVLFLPGFGVGSFHYEKQLTDLGRDYRVWAIDF
LGQGLSLPTEDPTTMTEETSSSEDKEPFWGFGDKTEPWADQLVFSLDLWR
DQVQYFVEEVIGEPVYIAGNSLGGYVALYFAATHPHLVKGVTLLNATPFW
GFFPNPVRSPKLARLFPWPGAFPLPERVKKITELVWQKISDPESIAEILK
QVYTDHSINVDKVFSRIVEVTQHPAAAASFASIMLAPGGELSFSEALSRC
KENNVQICLMYGREDPWVRPLWGKKIKKEIPNAPYYEISPAGHCPHDEVP
EVVNYLMRGWIKHLESGGFEALPLLEDTEEDWEESRIGREIEFPRDGWKK
AVNLWLYGSNYTYWRGVRESFRSSFIRVFGGKSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEIISLNVVPQCSVVTWSSKLATKRLVPNRSSLLFSGVKKSRLVIRSGNS
DGYVVGENDDLGRIARRGESTSKVLIPGLPDESNGEIAARISHSHCEWKP
KLRVHYEKAGCDNLDAPAVLFLPGFGVGSFHYEKQLTDLGRDYRVWAIDF
LGQGLSLPTEDPTTMTEETSSSEDKEPFWGFGDKTEPWADQLVFSLDLWR
DQVQYFVEEVIGEPVYIAGNSLGGYVALYFAATHPHLVKGVTLLNATPFW
GFFPNPVRSPKLARLFPWPGAFPLPERVKKITELVWQKISDPESIAEILK
QVYTDHSINVDKVFSRIVEVTQHPAAAASFASIMLAPGGELSFSEALSRC
KENNVQICLMYGREDPWVRPLWGKKIKKEIPNAPYYEISPAGHCPHDEVP
EVVNYLMRGWIKHLESGGFEALPLLEDTEEDWEESRIGREIEFPRDGWKK
AVNLWLYGSNYTYWRGVRESFRSSFIRVFGGKSA


References
1 more
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Pheophytin pheophorbide hydrolase (pheophytinase) is involved in chlorophyll breakdown during leaf senescence in Arabidopsis
    Schelbert S, Aubry S, Burla B, Agne B, Kessler F, Krupinska K, Hortensteiner S
    Ref: Plant Cell, 21:767, 2009 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence features of the 1.6 Mb regions covered by twenty physically assigned P1 clones
    Sato S, Kotani H, Nakamura Y, Kaneko T, Asamizu E, Fukami M, Miyajima N, Tabata S
    Ref: DNA Research, 4:215, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer