Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-Q9LVX9

Arabidopsis thaliana At5g36180 (Mouse-ear cress) serine carboxypeptidase

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AK221746, AB018112
2 UniProt : Q8RWJ6, Q56XC9
2 UniProt : Q8RWJ6, Q56XC9
2 Interpro : Q8RWJ6, Q56XC9
2 Prodom : Q8RWJ6, Q56XC9
2 Pfam : Q8RWJ6, Q56XC9
2 PIRSF : Q8RWJ6, Q56XC9
2 SUPERFAM : Q8RWJ6, Q56XC9
1 Tair database : At5g36180
Sequence
Graphical view for this peptide sequence: arath-Q9LVX9
Colored MSA for Carboxypeptidase_S10 (raw)
MANKYVSSVLKSLLVLLHLVFLSKQHVDSASIVKSLPGFEGQLPFELETG
YIGVGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPGCSAISGLLFENGP
LTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTQQFNKP
SDSGEAKRIHEFLQKWLGKHQVFSSNPFYVAGDSYSGLVVPATVQEISKG
NYECCNPPINLQGYVLGNPLTDYTTGSNSRIPFAHGMALISDELYESLKK
TCKGEYTNVHPRNTQCLKFVEEFNKCTNRIFQQLILDPLCETETPDCYIY
RYLLTTYWANDATVREALQINKESIGEWVRCYYSIPYNNDIKSSMPYHVN
NSISGYRSLIYSGDHDFEVPYLGTQAWIRSLNYSIIDDWRPWMVKNQIAG
YTRTYANKMTFATIKGGGHTAESKPEEASIMFQRSFVEAPLGQWLTKGSL
MLLQQDVWGSSPNYCDLLVDLQINGGKCAGDLQRCTIMDLIRKKKTKRSF
SSILDWIKVARF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANKYVSSVLKSLLVLLHLVFLSKQHVDSASIVKSLPGFEGQLPFELETG
YIGVGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPGCSAISGLLFENGP
LTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTQQFNKP
SDSGEAKRIHEFLQKWLGKHQVFSSNPFYVAGDSYSGLVVPATVQEISKG
NYECCNPPINLQGYVLGNPLTDYTTGSNSRIPFAHGMALISDELYESLKK
TCKGEYTNVHPRNTQCLKFVEEFNKCTNRIFQQLILDPLCETETPDCYIY
RYLLTTYWANDATVREALQINKESIGEWVRCYYSIPYNNDIKSSMPYHVN
NSISGYRSLIYSGDHDFEVPYLGTQAWIRSLNYSIIDDWRPWMVKNQIAG
YTRTYANKMTFATIKGGGHTAESKPEEASIMFQRSFVEAPLGQWLTKGSL
MLLQQDVWGSSPNYCDLLVDLQINGGKCAGDLQRCTIMDLIRKKKTKRSF
SSILDWIKVARF


Reference
    Title: Structural analysis of Arabidopsis thaliana chromosome 5. X. Sequence features of the regions of 3,076,755 bp covered by sixty P1 and TAC clones
    Sato S, Nakamura Y, Kaneko T, Katoh T, Asamizu E, Kotani H, Tabata S
    Ref: DNA Research, 7:31, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer