arath-SCP13

 
Arabidopsis thaliana (Mouse-ear cress) F21P24.4 T20K9.20 SCPL13 At2g22980 putative serine carboxypeptidase I

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: AC004401, AF410326, AY093062
>3 UniProt links 1 more: Q8RWI5, A8MQG4, Q8H780
>3 UniProtTrembl links 1 more: Q8RWI5, Q8H780, A8MQG4
>3 Interpro links 1 more: Q8RWI5, Q8H780, A8MQG4
>3 Prodom links 1 more: Q8RWI5, Q8H780, A8MQG4
>3 Pfam links 1 more: Q8RWI5, Q8H780, A8MQG4
>3 PIRSF links 1 more: Q8RWI5, Q8H780, A8MQG4
>3 SUPERFAM links 1 more: Q8RWI5, Q8H780, A8MQG4
>3 QuickSwissBlast links 1 more: Q8RWI5, Q8H780, A8MQG4
1 Tair database : At2g22980
 
Sequence
Graphical view for this peptide sequence: arath-SCP13
Colored MSA for Carboxypeptidase_S10 (raw)
MSLTLEFLLLLIVLILSHHAHSGSIVKFLPGFEGPLPFELETGYIGIGEE
EEVQLFYYFIKSEKNPEEDPLLLWLSGGPGCSSLTGLLFENGPVALKFEV
YNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRTPLVDKISDTGEVK
RIYEFLQKWLSKHQQFFSNPFYVGGDSYSGMIVPPLVQEIGKGNYQINLQ
GYILGNPITDTESEQNYQIPYAHGMALISDELYKSMERICKGNYVKVDSL
NTKCYKLIKDYQKCIHKLNKYHILLPDCDITSPDCFLYRYTLITFWANNK
SVREALQVNKGSIGKWVQCNYKNISYNYDIKSSVAYHMKNSIDGYRSLIY
NGDHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQIAGYTRSYSNKMTF
ATIKGSGHTAEYKPKETSIMFKRWISAQPL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLTLEFLLLLIVLILSHHAHSGSIVKFLPGFEGPLPFELETGYIGIGEE
EEVQLFYYFIKSEKNPEEDPLLLWLSGGPGCSSLTGLLFENGPVALKFEV
YNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRTPLVDKISDTGEVK
RIYEFLQKWLSKHQQFFSNPFYVGGDSYSGMIVPPLVQEIGKGNYQINLQ
GYILGNPITDTESEQNYQIPYAHGMALISDELYKSMERICKGNYVKVDSL
NTKCYKLIKDYQKCIHKLNKYHILLPDCDITSPDCFLYRYTLITFWANNK
SVREALQVNKGSIGKWVQCNYKNISYNYDIKSSVAYHMKNSIDGYRSLIY
NGDHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQIAGYTRSYSNKMTF
ATIKGSGHTAEYKPKETSIMFKRWISAQPL

no DNA




Reference
    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer