Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-SCP19

Arabidopsis thaliana Serine carboxypeptidase-like 19 MTH16.5 s

Comment
Trembl Q9FXX7 and Q9LXC8, MTH16.5 and F17I14_170 seem almost identical?? Trembl Q941P1 sinapoylglucose:choline sinapoyltransferase seem also identical SNG2; Called AtSCT


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB020752
1 Ncbi-nid : 3985955
1 Ncbi-pid : 9758992
1 UniProt : Q8VZU3
1 Interpro : Q8VZU3
1 Prodom : Q8VZU3
1 Pfam : Q8VZU3
1 PIRSF : Q8VZU3
1 SUPERFAM : Q8VZU3
1 Tair database : At5g09640
Sequence
Graphical view for this peptide sequence: arath-SCP19
Colored MSA for Carboxypeptidase_S10 (raw)
MRNLSFIVLFLLTLFFIHHLVDASLLVKSLPGFEGPLPFELETGYVSIGE
SGDVELFYYFVKSERNPENDPLMIWLTGGPGCSSICGLLFANGPLAFKGD
EYNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFESSDTKQM
HQIDQFLRSWFVKHPEFISNPFYVGGDSYSGKIVPGAVQQISLGNEKGLT
PLINIQGYVLGNPVTDKNIETNYRVPFAHGMGLISDELFESLERSCGGKF
FNVDPSNARCSNNLQAYDHCMSEIYSEHILLRNCKVDYVLADTPNIRTDR
RRVMKEFSVNDSSSLPPPSCFTYRYFLSAFWANDENVRRALGVKKEVGKW
NRCNSQNIPYTFEIFNAVPYHVNNSLKGFRSLIYSGDHDSMVPFSSTQAW
IRALNYSIVDDWRPWMMSSNQVAGYTRTYANKMTFATIKGGGHTAEYTPD
QCSLMFRRWIDGEPL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRNLSFIVLFLLTLFFIHHLVDASLLVKSLPGFEGPLPFELETGYVSIGE
SGDVELFYYFVKSERNPENDPLMIWLTGGPGCSSICGLLFANGPLAFKGD
EYNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFESSDTKQM
HQIDQFLRSWFVKHPEFISNPFYVGGDSYSGKIVPGAVQQISLGNEKGLT
PLINIQGYVLGNPVTDKNIETNYRVPFAHGMGLISDELFESLERSCGGKF
FNVDPSNARCSNNLQAYDHCMSEIYSEHILLRNCKVDYVLADTPNIRTDR
RRVMKEFSVNDSSSLPPPSCFTYRYFLSAFWANDENVRRALGVKKEVGKW
NRCNSQNIPYTFEIFNAVPYHVNNSLKGFRSLIYSGDHDSMVPFSSTQAW
IRALNYSIVDDWRPWMMSSNQVAGYTRTYANKMTFATIKGGGHTAEYTPD
QCSLMFRRWIDGEPL


References
1 more
    Title: Structure determinants and substrate recognition of serine carboxypeptidase-like acyltransferases from plant secondary metabolism
    Stehle F, Brandt W, Milkowski C, Strack D
    Ref: FEBS Letters, 580:6366, 2006 : PubMed

            

    Title: The sng2 mutant of Arabidopsis is defective in the gene encoding the serine carboxypeptidase-like protein sinapoylglucose:choline sinapoyltransferase
    Shirley AM, McMichael CM, Chapple C
    Ref: Plant J, 28:83, 2001 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones
    Kaneko T, Katoh T, Sato S, Nakamura Y, Asamizu E, Kotani H, Miyajima N, Tabata S
    Ref: DNA Research, 6:183, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer