arath-SCP22

 
Arabidopsis thaliana (Mouse-ear cress) Serine carboxypeptidase-like 22 SCPL22 At2g24000

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AC005170, DQ446557, DQ446558
2 UniProt : Q1PF08, A6XH04
2 UniProtTrembl : Q1PF08, A6XH04
2 Interpro : Q1PF08, A6XH04
2 Prodom : Q1PF08, A6XH04
2 Pfam : Q1PF08, A6XH04
2 PIRSF : Q1PF08, A6XH04
2 SUPERFAM : Q1PF08, A6XH04
2 QuickSwissBlast : Q1PF08, A6XH04
1 Tair database : At2g24000
 
Sequence
Graphical view for this peptide sequence: arath-SCP22
Colored MSA for Carboxypeptidase_S10 (raw)
MARTHLLFLLFVLLSLATSSTSTKEQEEDRIKALPGQPKVGFSQFSGYVT
VNESHGRSLFYWLTESSSHSPHTKPLLLWLNGGWIFFLPTFPRPGCSSIA
YGASEEIGPFRISKTGCNLYLNNFSWNTEANLLFLESPVGVGFSYTNTSS
DFEESGDERTAQENLIFLISWMSRFPQYRYRDFYIVGESYAGHYVPQLAQ
KIHEYNNAYKNPVINLKGFMVGNPEMDKNNDRLGTITYWWSHAMISDASY
NRILKNCDFTADRFSKECDSAIYVAAADFGDIDQYSIYTPKCVPPQDQTN
QTKFEQMMQMHTTKRFLEDQYDPCTENYAEIYYNRPEVQRAMHANHTAIP
YKWTACSDSVFNNWNWRDSDNSMLPIYKELIAAGLRIWVYSGDTDSVIPV
TATRYSLGKLNLRVKTRWYPWYSGNQVGGRTEVYEGLTFVTVRGAGHEVP
FFQPQSALILLRSFLAGNELSRSY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARTHLLFLLFVLLSLATSSTSTKEQEEDRIKALPGQPKVGFSQFSGYVT
VNESHGRSLFYWLTESSSHSPHTKPLLLWLNGGWIFFLPTFPRPGCSSIA
YGASEEIGPFRISKTGCNLYLNNFSWNTEANLLFLESPVGVGFSYTNTSS
DFEESGDERTAQENLIFLISWMSRFPQYRYRDFYIVGESYAGHYVPQLAQ
KIHEYNNAYKNPVINLKGFMVGNPEMDKNNDRLGTITYWWSHAMISDASY
NRILKNCDFTADRFSKECDSAIYVAAADFGDIDQYSIYTPKCVPPQDQTN
QTKFEQMMQMHTTKRFLEDQYDPCTENYAEIYYNRPEVQRAMHANHTAIP
YKWTACSDSVFNNWNWRDSDNSMLPIYKELIAAGLRIWVYSGDTDSVIPV
TATRYSLGKLNLRVKTRWYPWYSGNQVGGRTEVYEGLTFVTVRGAGHEVP
FFQPQSALILLRSFLAGNELSRSY

no DNA




References
    Title: Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations
    Underwood BA, Vanderhaeghen R, Whitford R, Town CD, Hilson P
    Ref: Plant Biotechnol J, 4:317, 2006 : PubMed

            

    Title: An expression and bioinformatics analysis of the Arabidopsis serine carboxypeptidase-like gene family
    Fraser CM, Rider LW, Chapple C
    Ref: Plant Physiol, 138:1136, 2005 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer