Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-SCP42

Arabidopsis thaliana K5J14.4 At5g42240 SCPL42 serine carboxypeptidase II-like

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB023032
1 UniProt : Q9FH05
1 Ncbi-nid : 4220631
1 Ncbi-pid : 10177009
1 UniProt : Q9FH05
1 Interpro : Q9FH05
1 Pfam : Q9FH05
1 PIRSF : Q9FH05
1 SUPERFAM : Q9FH05
1 Tair database : At5g42240
Sequence
Graphical view for this peptide sequence: arath-SCP42
Colored MSA for Carboxypeptidase_S10 (raw)
MASVSWRAVAVAMVVVLLSLQWFAKGYPEEDLVVRLPGQPTVGFKQYAGY
VDVDVKAGRSLFYYYVEAVKQPDSKPLTLWLNGGPGCSSIGGGAFTELGP
FYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSDYNTGDKST
ANDMLVFLLRWFEKFPKLKSRDLFLTGESYAGHYIPQLADAILSYNSHSS
GFKFNIKGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITSQCDFD
DYTFASPHNVSTACNEAISETENIITEYVNNYDVLLDVCYPSIVQQELRL
KKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSWSMCSGVL
NYSDIDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQ
DLNFKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRA
LHLFSSFVSGRRLPNNTHSSTDE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASVSWRAVAVAMVVVLLSLQWFAKGYPEEDLVVRLPGQPTVGFKQYAGY
VDVDVKAGRSLFYYYVEAVKQPDSKPLTLWLNGGPGCSSIGGGAFTELGP
FYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSDYNTGDKST
ANDMLVFLLRWFEKFPKLKSRDLFLTGESYAGHYIPQLADAILSYNSHSS
GFKFNIKGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITSQCDFD
DYTFASPHNVSTACNEAISETENIITEYVNNYDVLLDVCYPSIVQQELRL
KKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSWSMCSGVL
NYSDIDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQ
DLNFKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRA
LHLFSSFVSGRRLPNNTHSSTDE


Reference
    Title: Structural analysis of Arabidopsis thaliana chromosome 5. X. Sequence features of the regions of 3,076,755 bp covered by sixty P1 and TAC clones
    Sato S, Nakamura Y, Kaneko T, Katoh T, Asamizu E, Kotani H, Tabata S
    Ref: DNA Research, 7:31, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer