Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-T6L1.8

Arabidopsis thaliana (Mouse-ear cress) At1g68900 Protein PHYLLO, chloroplastic last domain

Comment
only c-term PfamA Abhydrolase_1 407 501


Relationship
Family|MenH_SHCHC
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AC011665, AK226959, DQ084386
1 UniProt : Q15KI9
1 UniProt : Q15KI9
1 Interpro : Q15KI9
1 Pfam : Q15KI9
1 PIRSF : Q15KI9
1 SUPERFAM : Q15KI9
1 Tair database : At1g68900
Sequence
Graphical view for this peptide sequence: arath-T6L1.8
Colored MSA for MenH_SHCHC (raw)
LHGFLGTGEEWIPIMTGISGSARCISVDIPGHGRSRVQSHASETQTSPTF
SMEMIAEALYKLIEQITPGKVTIVGYSMGARIALYMALRFSNKIEGAVVV
SGSPGLKDPVARKIRSATDDSKARMMVDNGLYIFIENWYNGGLWKSKIAA
SRLLHGDVPSVAKLLSDLSSGRQPSLWEELEDCDTNISLVFGEKDVKYKQ
IATRMYREMSKSKKSVNNIIEIVEIPEAGHAVHLESPLRVILALRKFLTR
VHNSSTETELSQKLLLALKEM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LHGFLGTGEEWIPIMTGISGSARCISVDIPGHGRSRVQSHASETQTSPTF
SMEMIAEALYKLIEQITPGKVTIVGYSMGARIALYMALRFSNKIEGAVVV
SGSPGLKDPVARKIRSATDDSKARMMVDNGLYIFIENWYNGGLWKSKIAA
SRLLHGDVPSVAKLLSDLSSGRQPSLWEELEDCDTNISLVFGEKDVKYKQ
IATRMYREMSKSKKSVNNIIEIVEIPEAGHAVHLESPLRVILALRKFLTR
VHNSSTETELSQKLLLALKEM


References
    Title: A plant locus essential for phylloquinone (vitamin K1) biosynthesis originated from a fusion of four eubacterial genes
    Gross J, Cho WK, Lezhneva L, Falk J, Krupinska K, Shinozaki K, Seki M, Herrmann RG, Meurer J
    Ref: Journal of Biological Chemistry, 281:17189, 2006 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer