arath-ZW18

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) ZW18 protein (F19C14.4 protein) At1g58350

Comment
only c-term PfamA DUF676 508 710


Relationship
Family Duf_676
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AB028199, AC008051
2 UniProt : Q9SLU9, D7KY64
2 UniProtTrembl : Q9SLU9, D7KY64
2 Interpro : Q9SLU9, D7KY64
2 Prodom : Q9SLU9, D7KY64
2 Pfam : Q9SLU9, D7KY64
2 PIRSF : Q9SLU9, D7KY64
2 SUPERFAM : Q9SLU9, D7KY64
2 QuickSwissBlast : Q9SLU9, D7KY64
1 Tair database : At1g58350
 
Sequence
Graphical view for this peptide sequence: arath-ZW18
Colored MSA for Duf_676 (raw)
KVTNSQQSARELKIVVFVHGFQGHHLDLRLVRNQWLLIDPKIEFLMSEAN
EEKTHGDFREMGQRLAQEVVSFLKRKKDRYARQGHLKSIKLSFVGHSIGN
VIIRTAIADSLMEPYRKYLHTYLSLSGPHLGYLYSTNSLFNSGLWLLKKL
KSTQVIHQLTLTDDPDLRHTFFYKLCKQKTLENFKNIILLSSPQDGYVPY
HSARIESCQPASFDSSKRGVAFLEMLNNCLDQIRGPVPEAPHQQRVFMRC
DVNFDMTVYGRNLNSFIGRAAHIEFLESDIFARFIMWSFQDLFR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KVTNSQQSARELKIVVFVHGFQGHHLDLRLVRNQWLLIDPKIEFLMSEAN
EEKTHGDFREMGQRLAQEVVSFLKRKKDRYARQGHLKSIKLSFVGHSIGN
VIIRTAIADSLMEPYRKYLHTYLSLSGPHLGYLYSTNSLFNSGLWLLKKL
KSTQVIHQLTLTDDPDLRHTFFYKLCKQKTLENFKNIILLSSPQDGYVPY
HSARIESCQPASFDSSKRGVAFLEMLNNCLDQIRGPVPEAPHQQRVFMRC
DVNFDMTVYGRNLNSFIGRAAHIEFLESDIFARFIMWSFQDLFR

no DNA




References
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            

    Title: Isolation and analysis of cDNA within a 300 kb Arabidopsis thaliana genomic region located around the 100 map unit of chromosome 1
    Kato A, Suzuki M, Kuwahara A, Ooe H, Higano-Inaba K, Komeda Y
    Ref: Gene, 239:309, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer