arath-clh1

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) (chlase 1) (coronatine-induced protein 1) (cori1) AT1G19670

Comment
Other strains: Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) subsp. petraea (Northern rock-cress) (Cardaminopsis petraea)


Relationship
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Chlorophyll ,

>3 Genbank links 36 more: AF021244, AC007797, AY099815
>3 UniProt links 6 more: O22527, D7KI46, M9P450
>3 UniProtTrembl links 7 more: O22527, D7KI46, M9P450
>3 Interpro links 7 more: O22527, D7KI46, M9P450
>3 Prodom links 7 more: O22527, D7KI46, M9P450
>3 Pfam links 7 more: O22527, D7KI46, M9P450
>3 PIRSF links 7 more: O22527, D7KI46, M9P450
>3 SUPERFAM links 7 more: O22527, D7KI46, M9P450
>3 QuickSwissBlast links 7 more: O22527, D7KI46, M9P450
1 Tair database : AT1G19670
 
Sequence
Graphical view for this peptide sequence: arath-clh1
Colored MSA for Chlorophyllase (raw)
MAAIEDSPTFSSVVTPAAFEIGSLPTTEIPVDPVENDSTAPPKPVRITCP
TVAGTYPVVLFFHGFYLRNYFYSDVLNHIASHGYILVAPQLCKLLPPGGQ
VEVDDAGSVINWASENLKAHLPTSVNANGKYTSLVGHSRGGKTAFAVALG
HAATLDPSITFSALIGIDPVAGTNKYIRTDPHILTYKPESFELDIPVAVV
GTGLGPKWNNVMPPCAPTDLNHEEFYKECKATKAHFVAADYGHMDMLDDD
LPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEIRLIV
KDPSVSPAKLDPSPELEEASGIFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAIEDSPTFSSVVTPAAFEIGSLPTTEIPVDPVENDSTAPPKPVRITCP
TVAGTYPVVLFFHGFYLRNYFYSDVLNHIASHGYILVAPQLCKLLPPGGQ
VEVDDAGSVINWASENLKAHLPTSVNANGKYTSLVGHSRGGKTAFAVALG
HAATLDPSITFSALIGIDPVAGTNKYIRTDPHILTYKPESFELDIPVAVV
GTGLGPKWNNVMPPCAPTDLNHEEFYKECKATKAHFVAADYGHMDMLDDD
LPGFVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEIRLIV
KDPSVSPAKLDPSPELEEASGIFV

no DNA




References
5 more
    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            

    Title: Differential expression of a novel gene in response to coronatine, methyl jasmonate, and wounding in the Coi1 mutant of Arabidopsis
    Benedetti CE, Costa CL, Turcinelli SR, Arruda P
    Ref: Plant Physiol, 116:1037, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer