Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-eds1

Arabidopsis thaliana lipase homolog (EDS1) (Enhanced disease susceptibility 1-like) At3g48090 AtEDS1

Comment
EDS1, an essential component of R gene-mediated disease resistance The Arabidopsis EDS1 (arath-eds1) and PAD4 (arath-F22O6.190) genes encode lipase-like proteins that function in resistance (R) gene-mediated and basal plant disease resistance.EDS1 can dimerize and interact with PAD4 or with SAG101 (arath-At5g14930). Plants utilise intracellular nucleotide-binding, leucine-rich repeat (NLR) immune receptors to detect pathogen effectors and activate local and systemic defence. NRG1 and ADR1 'helper' NLRs (RNLs) cooperate with enhanced disease susceptibility 1 (EDS1), senescence-associated gene 101 (SAG101) and phytoalexin-deficient 4 (PAD4) lipase-like proteins to mediate signalling from TIR domain NLR receptors (TNLs). Two distinct modules (NRG1/EDS1/SAG101 and ADR1/EDS1/PAD4) mediate TNL receptor defence signalling


Relationship
Family|Plant_lipase_EDS1-like
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
7 structures (e.g. : 4NFU, 6I8G, 6I8H... more)
No kinetic





3 substrates: ADP-ribose, pRib-ADP, pRib-AMP
No inhibitor
>3 Genbank links 1 more: AF128407, AL049658, NP_001030829
>3 UniProt links 11 more: Q9XF23, Q9SU72, B2BDD6
1 Ncbi-nid : 4454566
1 Ncbi-pid : 4454567
>3 Structure links 4 more: 7XDD, 7XEY, 7XJP
>3 UniProt links 12 more: Q9XF23, Q9SU72, B2BDD6
>3 Interpro links 12 more: Q9XF23, Q9SU72, B2BDD6
>3 Prodom links 12 more: Q9XF23, Q9SU72, B2BDD6
>3 Pfam links 12 more: Q9XF23, Q9SU72, B2BDD6
>3 PIRSF links 12 more: Q9XF23, Q9SU72, B2BDD6
>3 SUPERFAM links 12 more: Q9XF23, Q9SU72, B2BDD6
1 Tair database : At3g48090
Sequence
Graphical view for this peptide sequence: arath-eds1
Colored MSA for Plant_lipase_EDS1-like (raw)
MAFEALTGINGDLITRSWSASKQAYLTERYHKEEAGAVVIFAFQPSFSEK
DFFDPDNKSSFGEIKLNRVQFPCMRKIGKGDVATVNEAFLKNLEAVIDPR
TSFQASVEMAVRSRKQIVFTGHSSGGATAILATVWYLEKYFIRNPNVYLE
PRCVTFGAPLVGDSIFSHALGREKWSRFFVNFVTRFDIVPRITLARKASV
EETLPHVLAQLDPRNSSVQESEQRITEFYTSVMRDTSTVANQAVCELTGS
AEAILETLSSFLELSPYRPAGTFVFSTEKRLVAVNNSDAILQMLFYTCQA
SDEQEWSLIPFRSIRDHHSYEELVQSMGMKLFNHLDGENSIESSLNDLGV
STRGRQYVQAALEEEKKRVENQKKIIQVIQQERFLKKLAWIEDEYKPKCQ
AHKNGYYDSFKVSNEENDFKANVKRAELAGVFDEVLGLLKKCQLPDEFEG
DIDWIKLATRYRRLVEPLDIANYHRHLKNEDTGPYMKRGRPTRYIYAQRG
YEHHILKPNGMIAEDVFWNKVNGLNLGLQLEEIQETLKNSGSECGSCFWA
EVEELKGKPYEEVEVRVKTLEGMLREWITAGEVDEKEIFLEGSTFRKWWI
TLPKNHKSHSPLRDYMMDEITDT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAFEALTGINGDLITRSWSASKQAYLTERYHKEEAGAVVIFAFQPSFSEK
DFFDPDNKSSFGEIKLNRVQFPCMRKIGKGDVATVNEAFLKNLEAVIDPR
TSFQASVEMAVRSRKQIVFTGHSSGGATAILATVWYLEKYFIRNPNVYLE
PRCVTFGAPLVGDSIFSHALGREKWSRFFVNFVTRFDIVPRITLARKASV
EETLPHVLAQLDPRNSSVQESEQRITEFYTSVMRDTSTVANQAVCELTGS
AEAILETLSSFLELSPYRPAGTFVFSTEKRLVAVNNSDAILQMLFYTCQA
SDEQEWSLIPFRSIRDHHSYEELVQSMGMKLFNHLDGENSIESSLNDLGV
STRGRQYVQAALEEEKKRVENQKKIIQVIQQERFLKKLAWIEDEYKPKCQ
AHKNGYYDSFKVSNEENDFKANVKRAELAGVFDEVLGLLKKCQLPDEFEG
DIDWIKLATRYRRLVEPLDIANYHRHLKNEDTGPYMKRGRPTRYIYAQRG
YEHHILKPNGMIAEDVFWNKVNGLNLGLQLEEIQETLKNSGSECGSCFWA
EVEELKGKPYEEVEVRVKTLEGMLREWITAGEVDEKEIFLEGSTFRKWWI
TLPKNHKSHSPLRDYMMDEITDT


References
21 more
    Title: Cavity surface residues of PAD4 and SAG101 contribute to EDS1 dimer signaling specificity in plant immunity
    Dongus JA, Bhandari DD, Penner E, Lapin D, Stolze SC, Harzen A, Patel M, Archer L, Dijkgraaf L and Parker JE <2 more author(s)>
    Ref: Plant J, :, 2022 : PubMed

            

    Title: Identification and receptor mechanism of TIR-catalyzed small molecules in plant immunity
    Huang S, Jia A, Song W, Hessler G, Meng Y, Sun Y, Xu L, Laessle H, Jirschitzka J and Chai J <10 more author(s)>
    Ref: Science, :, 2022 : PubMed

            

    Title: Pathogen effector recognition-dependent association of NRG1 with EDS1 and SAG101 in TNL receptor immunity
    Sun X, Lapin D, Feehan JM, Stolze SC, Kramer K, Dongus JA, Rzemieniewski J, Blanvillain-Baufume S, Harzen A and Parker JE <6 more author(s)>
    Ref: Nat Commun, 12:3335, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer