Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-o65513

Arabidopsis thaliana (Mouse-ear cress) Putative uncharacterized protein F23E13.100 At4g36210

Relationship
Family|Duf_726
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AL022141, AL161589
2 UniProt : O65513, B3H797
2 UniProt : O65513, B3H797
2 Interpro : O65513, B3H797
2 Prodom : O65513, B3H797
2 Pfam : O65513, B3H797
2 PIRSF : O65513, B3H797
2 SUPERFAM : O65513, B3H797
1 Tair database : At4g36210
Sequence
Graphical view for this peptide sequence: arath-o65513
Colored MSA for Duf_726 (raw)
KRCRKGYDARHRVALRLLATWFNIEWIKVEAIETMVACSAMAIQKSAEMK
GEDNLTPTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALA
PTLGTIIPVIGAGGFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARR
IGDLDEFEFKAIGENHNQGRLAVEVLVAGVVFEEEDFVKPWEGLTSNLER
YTLQWESKNLILVSTAIQDWLTSRLAMELMKQGAMHTVLASLLMALAWPA
TILVAADFIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITLVGFSLGA
RVIFKCLQALAETEQNAELVERVVLLGAPISINSENWRDVRKMVAGRFIN
VYATNDWTLGIAFRASLISQGLAGIQPICIPGIENVDVTDMVEGHSSYLW
KTQQILERLEIDTYYPVFRDTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KRCRKGYDARHRVALRLLATWFNIEWIKVEAIETMVACSAMAIQKSAEMK
GEDNLTPTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALA
PTLGTIIPVIGAGGFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARR
IGDLDEFEFKAIGENHNQGRLAVEVLVAGVVFEEEDFVKPWEGLTSNLER
YTLQWESKNLILVSTAIQDWLTSRLAMELMKQGAMHTVLASLLMALAWPA
TILVAADFIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITLVGFSLGA
RVIFKCLQALAETEQNAELVERVVLLGAPISINSENWRDVRKMVAGRFIN
VYATNDWTLGIAFRASLISQGLAGIQPICIPGIENVDVTDMVEGHSSYLW
KTQQILERLEIDTYYPVFRDTL


Reference
    Title: Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana
    Mayer K, Schuller C, Wambutt R, Murphy G, Volckaert G, Pohl T, Dusterhoft A, Stiekema W, Entian KD and McCombie WR <220 more author(s)>
    Ref: Nature, 402:769, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer