Gene_Locus Report
Biblio print
Add to basket
Go to basket
Tree Display
AceDB Schema
XML Display
Feedback

Gene_locus Report for: arath-pip

Arabidopsis thaliana, Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) proline iminopeptidase T1O16.15 At2g14260

Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AC006304
>3 UniProt links 1 more: P93732, D7L1S3, C0Z3J2
1 Ncbi-nid : 6598556
3 Ncbi-pid : 4406804, U72711, 1710151
>3 UniProt links 1 more: P93732, Q941B5, D7L1S3
>3 Interpro links 1 more: P93732, Q941B5, D7L1S3
>3 Pfam links 1 more: P93732, Q941B5, D7L1S3
>3 PIRSF links 1 more: P93732, Q941B5, D7L1S3
>3 SUPERFAM links 1 more: P93732, Q941B5, D7L1S3
1 Tair database : At2g14260
Sequence
Peptide
Graphical view for this peptide sequence: arath-pip
Colored MSA for Proline_iminopeptidase (raw) 
MEPHEAETFVNKRTLYAPIEPYSSGNLKVSDVHTLYWEQSGKPDGHPVVF
LHGGPGGGTAPSNRRFFDPEFYRIVLFDQRGAGKSTPHACLEENTTWDLV
NDIEKLREHLKIPEWLVFGGSWGSTLALAYSQSHPDKVTGLVLRGIFLLR
KKEIDWFYEGGAAAIYPDAWEEFRDLIPENERGSSLVDAYHKRLNSDDLE
IQYAAARAWTKWEMMTAYLRPNLENVQKAEDDKFSLAFARIENHYFVNKG
FFPSDSHLLDNVDKIRHIKTTIVQGRYDVCCPMMSAWDLHKAWPEAELKI
VYDAGHSANEPGISAELVVANEKMKALMG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MEPHEAETFVNKRTLYAPIEPYSSGNLKVSDVHTLYWEQSGKPDGHPVVF
LHGGPGGGTAPSNRRFFDPEFYRIVLFDQRGAGKSTPHACLEENTTWDLV
NDIEKLREHLKIPEWLVFGGSWGSTLALAYSQSHPDKVTGLVLRGIFLLR
KKEIDWFYEGGAAAIYPDAWEEFRDLIPENERGSSLVDAYHKRLNSDDLE
IQYAAARAWTKWEMMTAYLRPNLENVQKAEDDKFSLAFARIENHYFVNKG
FFPSDSHLLDNVDKIRHIKTTIVQGRYDVCCPMMSAWDLHKAWPEAELKI
VYDAGHSANEPGISAELVVANEKMKALMG

References
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Analysis of multiple occurrences of alternative splicing events in Arabidopsis thaliana using novel sequenced full-length cDNAs
    Iida K, Fukami-Kobayashi K, Toyoda A, Sakaki Y, Kobayashi M, Seki M, Shinozaki K
    Ref: DNA Research, 16:155, 2009 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer