Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: artan-a0a2u1li82

Artemisia annua (Sweet wormwood) Alpha/beta-Hydrolases superfamily protein

Relationship
Family|Bodyguard
Block| X
Position in NCBI Life Tree|Artemisia annua
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > campanulids: N E > Asterales: N E > Asteraceae: N E > Asteroideae: N E > Anthemideae: N E > Artemisiinae: N E > Artemisia: N E > Artemisia annua: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A2U1LI82
1 Interpro : A0A2U1LI82
1 Prodom : A0A2U1LI82
1 Pfam : A0A2U1LI82
1 PIRSF : A0A2U1LI82
1 SUPERFAM : A0A2U1LI82
Sequence
Graphical view for this peptide sequence: artan-a0a2u1li82
Colored MSA for Bodyguard (raw)
MWEQNLGFGGKMGVTKMLKALAVIGNFVNDVLSFVIFSILDILDLILCHV
YKVIDFFIEAEWKPCYCSSPKEAITSSSGKILVSEKGESKKIVCLTSTKL
QLEEISDTLYTRPSLVSEVSKTTVKELKRRKINDKTTVVASINKATVMST
FTVNNTIVEMLQEKIVAHKSHPIPRWSDCDCDTCNSWSSSCKDTLFVHTD
GPKDKVEDDVLFIHGFISSSAFWTETVFPNFTKSTKSRYRLFAIDLLGFG
QSPKPHDSLYTIKEHLDMIEKSVLEEHKVKSFHIVAHSLGCLLALALAVK
YPNSVKSLTLLAPPFFPTPKGEQATQYMMRKVAPRRVWPLIAFGASLACW
YEHVSRTICLLICKNHRIWEFLTKLITRNRIKTYLIKGFCCHTHNAAWHT
LHNIICGTAGKIEGYLDIVQNKLTCSVNIFHGQDDELIPVECSSHVKNKI
PRANIKVVEKKDHITIVVGRQEAFARELEEIWNSSKQSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWEQNLGFGGKMGVTKMLKALAVIGNFVNDVLSFVIFSILDILDLILCHV
YKVIDFFIEAEWKPCYCSSPKEAITSSSGKILVSEKGESKKIVCLTSTKL
QLEEISDTLYTRPSLVSEVSKTTVKELKRRKINDKTTVVASINKATVMST
FTVNNTIVEMLQEKIVAHKSHPIPRWSDCDCDTCNSWSSSCKDTLFVHTD
GPKDKVEDDVLFIHGFISSSAFWTETVFPNFTKSTKSRYRLFAIDLLGFG
QSPKPHDSLYTIKEHLDMIEKSVLEEHKVKSFHIVAHSLGCLLALALAVK
YPNSVKSLTLLAPPFFPTPKGEQATQYMMRKVAPRRVWPLIAFGASLACW
YEHVSRTICLLICKNHRIWEFLTKLITRNRIKTYLIKGFCCHTHNAAWHT
LHNIICGTAGKIEGYLDIVQNKLTCSVNIFHGQDDELIPVECSSHVKNKI
PRANIKVVEKKDHITIVVGRQEAFARELEEIWNSSKQSK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer