Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: artni-Q93NG6

Arthrobacter nicotinovorans 2,6-dihydropseudooxynicotine hydrolase DHPON hydrolase

Relationship
Family|Duf_1100-S
Block| X
Position in NCBI Life Tree|Arthrobacter nicotinovorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Micrococcaceae: N E > Paenarthrobacter: N E > Paenarthrobacter nicotinovorans: N E


Molecular evidence
Database
No mutation
1 structure:
2JBW: Crystal structure of the 2,6-Dihydroxy-pseudo-oxynicotine hydrolase
No kinetic





1 substrate:
6-Hydroxypseudooxynicotine
No inhibitor
>3 Genbank links 1 more: AAK64252, CAD47941, WP_016359452
1 UniProt : Q93NG6
1 Structure : 2JBW
1 UniProt : Q93NG6
1 Interpro : Q93NG6
1 Prodom : Q93NG6
1 Pfam : Q93NG6
1 PIRSF : Q93NG6
1 SUPERFAM : Q93NG6
Sequence
Graphical view for this peptide sequence: artni-Q93NG6
Colored MSA for Duf_1100-S (raw)
MTVTSQVKPEDEMLNWGRLILDGVSYSDMVGARDRPKEITWFDYWMSLAN
EYEQEAERKVALGHDLSAGELLMSAALCAQYAQFLWFDERRQKGQARKVE
LYQKAAPLLSPPAERHELVVDGIPMPVYVRIPEGPGPHPAVIMLGGLEST
KEESFQMENLVLDRGMATATFDGPGQGEMFEYKRIAGDYEKYTSAVVDLL
TKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACISWGGFSDLDYWDL
ETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHD
EVPLSFVDTVLELVPAEHLNLVVEKDGDHCCHNLGIRPRLEMADWLYDVL
VAGKKVAPTMKGWPLNG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTVTSQVKPEDEMLNWGRLILDGVSYSDMVGARDRPKEITWFDYWMSLAN
EYEQEAERKVALGHDLSAGELLMSAALCAQYAQFLWFDERRQKGQARKVE
LYQKAAPLLSPPAERHELVVDGIPMPVYVRIPEGPGPHPAVIMLGGLEST
KEESFQMENLVLDRGMATATFDGPGQGEMFEYKRIAGDYEKYTSAVVDLL
TKLEAIRNDAIGVLGRSLGGNYALKSAACEPRLAACISWGGFSDLDYWDL
ETPLTKESWKYVSKVDTLEEARLHVHAALETRDVLSQIACPTYILHGVHD
EVPLSFVDTVLELVPAEHLNLVVEKDGDHCCHNLGIRPRLEMADWLYDVL
VAGKKVAPTMKGWPLNG


References
5 more
    Title: Structure and action of a C-C bond cleaving alpha/beta-hydrolase involved in nicotine degradation
    Schleberger C, Sachelaru P, Brandsch R, Schulz GE
    Ref: Journal of Molecular Biology, 367:409, 2007 : PubMed

            

    Title: An alpha/beta-fold C--C bond hydrolase is involved in a central step of nicotine catabolism by Arthrobacter nicotinovorans
    Sachelaru P, Schiltz E, Igloi GL, Brandsch R
    Ref: Journal of Bacteriology, 187:8516, 2005 : PubMed

            

    Title: Gene cluster on pAO1 of Arthrobacter nicotinovorans involved in degradation of the plant alkaloid nicotine: cloning, purification, and characterization of 2,6-dihydroxypyridine 3-hydroxylase
    Baitsch D, Sandu C, Brandsch R, Igloi GL
    Ref: Journal of Bacteriology, 183:5262, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer