Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: artot-a0a516ux40

Arthroderma otae (Microsporum canis) FSH1 protein

Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Arthroderma otae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Onygenales: N E > Arthrodermataceae: N E > Microsporum: N E > Microsporum canis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : QDQ70820
1 UniProt : A0A516UX40
1 UniProt : A0A516UX40
1 Interpro : A0A516UX40
1 Prodom : A0A516UX40
1 Pfam : A0A516UX40
1 PIRSF : A0A516UX40
1 SUPERFAM : A0A516UX40
Sequence
Graphical view for this peptide sequence: artot-a0a516ux40
Colored MSA for FSH1 (raw)
MRILCLHGVGSSGAVLEAQMANLQRELDPSFELVFVDGPFECERGPGVPE
YISGPFYSHTQGYSPAQIAQAVDYLEDLLEDEGPFDGIFGFSQGAALTLS
YFYRQQASASSLRARFACLFSAVMPCSPDEGMGDSIISRLRALEYDITDR
TRRNDEHLTPAEQEFVDVLQLTMVEAFIHDPLFPWTDLDVYRHGQHDAIP
RVMYPSLLAHKIQIPTVHVWGQNDAEYMIKMAEVARSLCEDSMAKTVLHA
GSHDVPKRQAEIKAVVRTFDWLLAQL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRILCLHGVGSSGAVLEAQMANLQRELDPSFELVFVDGPFECERGPGVPE
YISGPFYSHTQGYSPAQIAQAVDYLEDLLEDEGPFDGIFGFSQGAALTLS
YFYRQQASASSLRARFACLFSAVMPCSPDEGMGDSIISRLRALEYDITDR
TRRNDEHLTPAEQEFVDVLQLTMVEAFIHDPLFPWTDLDVYRHGQHDAIP
RVMYPSLLAHKIQIPTVHVWGQNDAEYMIKMAEVARSLCEDSMAKTVLHA
GSHDVPKRQAEIKAVVRTFDWLLAQL


Reference
    Title: FSH1 regulates the phenotype and pathogenicity of the pathogenic dermatophyte Microsporum canis
    Zhang F, Tan C, Xu Y, Yang G
    Ref: Int J Mol Med, 44:2047, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer