Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arts2-a0k0l7

Arthrobacter sp. (strain FB24) Phosphoribosyltransferase

Comment
only c-term Pfam A Abhydrolase_5 250 409


Relationship
Family|DLH-S
Block| X
Position in NCBI Life Tree|Arthrobacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Micrococcaceae: N E > Arthrobacter: N E > Arthrobacter sp.: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000454
1 UniProt : A0K0L7
1 UniProt : A0K0L7
1 Interpro : A0K0L7
1 Pfam : A0K0L7
1 PIRSF : A0K0L7
1 SUPERFAM : A0K0L7
Sequence
Graphical view for this peptide sequence: arts2-a0k0l7
Colored MSA for DLH-S (raw)
AVDEDVQIEAGAARLQGHLYVPVEGAAVVVFAHGSGSSRHSPRNRFVASF
LQRAGLGTLLLDLLTPAEELNRANVFDIGLLAGRLTGATEWLAGRPETAR
SRVGYFGASTGAGAALWAAAEPGARIGAVVSRGGRPDLAGDRLSAVRAPT
LLIVGGADREVLELNRWAQALLRCPSQLSVVPGATHLFEEPGTLSEAAAL
ARDWFLRYLQPGGDGAGD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

AVDEDVQIEAGAARLQGHLYVPVEGAAVVVFAHGSGSSRHSPRNRFVASF
LQRAGLGTLLLDLLTPAEELNRANVFDIGLLAGRLTGATEWLAGRPETAR
SRVGYFGASTGAGAALWAAAEPGARIGAVVSRGGRPDLAGDRLSAVRAPT
LLIVGGADREVLELNRWAQALLRCPSQLSVVPGATHLFEEPGTLSEAAAL
ARDWFLRYLQPGGDGAGD



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer