Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspaw-AXE1

Aspergillus luchuensis; Aspergillus awamori AlAXEA Acetylxylan esterase A Feruloyl esterase B

Comment
A. luchuensis, A. kawachii A. acidus and A. awamori are the same species, and A. luchuensis is selected as the correct name based on priority (Hong et al. 2013). Other strains: Aspergillus luchuensis CBS 106.47; Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) There are some differences in the sequences for the different entries. The sequence here is from the structure 5X6S


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Aspergillus luchuensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus luchuensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5X6S: Crystal structure Aspergillus luchuensis Acetylxylan esterase A
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: BAA13434, D87681, BCWF01000032
3 UniProt : A0A146FZJ9, G7XHV5, A0A1M3TE93
1 Structure : 5X6S
>3 UniProt links 1 more: Q92194, A0A146FZJ9, G7XHV5
>3 Interpro links 1 more: Q92194, A0A146FZJ9, G7XHV5
>3 Pfam links 1 more: Q92194, A0A146FZJ9, G7XHV5
>3 PIRSF links 1 more: Q92194, A0A146FZJ9, G7XHV5
>3 SUPERFAM links 1 more: Q92194, A0A146FZJ9, G7XHV5
Sequence
Graphical view for this peptide sequence: aspaw-AXE1
Colored MSA for Esterase_phb (raw)
SGSLQQVTDFGDNPTNVGMYIYVPNNLASNPGIVVAIHYCTGTGPGYYGD
SPYATLSEQYGFIVIYPSSPYSGGCWDVSSQATLTHNGGGNSNSIANMVT
WTISKYGADSSKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVSAGCF
YSNTNQVDGWNSTCAQGDVITTPEHWASIAEAMYSGYSGSRPRMQIYHGS
IDTTLYPQNYYETCKQWAGVFGYDYSAPEKTEANTPQTNYETTIWGDSLQ
GIFATGVGHTVPIHGDKDMEWFGFA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SGSLQQVTDFGDNPTNVGMYIYVPNNLASNPGIVVAIHYCTGTGPGYYGD
SPYATLSEQYGFIVIYPSSPYSGGCWDVSSQATLTHNGGGNSNSIANMVT
WTISKYGADSSKVFVTGSSSGAMMTNVMAATYPELFAAATVYSGVSAGCF
YSNTNQVDGWNSTCAQGDVITTPEHWASIAEAMYSGYSGSRPRMQIYHGS
IDTTLYPQNYYETCKQWAGVFGYDYSAPEKTEANTPQTNYETTIWGDSLQ
GIFATGVGHTVPIHGDKDMEWFGFA


References
3 more
    Title: Mutational analysis of a feruloyl esterase from Aspergillus awamori involved in substrate discrimination and pH dependence
    Koseki T, Takahashi K, Fushinobu S, Iefuji H, Iwano K, Hashizume K, Matsuzawa H
    Ref: Biochimica & Biophysica Acta, 1722:200, 2005 : PubMed

            

    Title: Biochemical characterization of recombinant acetyl xylan esterase from Aspergillus awamori expressed in Pichia pastoris: mutational analysis of catalytic residues
    Koseki T, Miwa Y, Fushinobu S, Hashizume K
    Ref: Biochimica & Biophysica Acta, 1749:7, 2005 : PubMed

            

    Title: An Aspergillus awamori acetylesterase: purification of the enzyme, and cloning and sequencing of the gene
    Koseki T, Furuse S, Iwano K, Sakai H, Matsuzawa H
    Ref: Biochemical Journal, 326 ( Pt 2):485, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer