aspcl-a1cdf0

 
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1). BEM46 family protein

Relationship
Block X
Aspergillus clavatus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus clavatus: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : DS027051, XP_001273303
1 UniProt : A1CDF0
1 UniProtTrembl : A1CDF0
1 Interpro : A1CDF0
1 Prodom : A1CDF0
1 Pfam : A1CDF0
1 PIRSF : A1CDF0
1 SUPERFAM : A1CDF0
1 QuickSwissBlast : A1CDF0
 
Sequence
Graphical view for this peptide sequence: aspcl-a1cdf0
Colored MSA for ABHD13-BEM46 (raw)
MSDSPPPPPSWSIAAMANNAVHFLRLPVLASSGLAVVASGLLYFKQNELI
YPRNVPVDARTNVPSPRQFGLNDYEDLQIPTPDGESLHAFFIRPENKQHA
RNVTVLMFHGNAGNIGHRVPIAKVLQEVLSCNVLMLEYRGYGLSTGVPDE
AGLKVDAQTGLDYLRQRAETRDTKIVIYGQSIGGAVAINLVAENQDSGDV
GGLILENTFLSIRKLIPTVFPPARYLARLCHQYWTSEEVLPKIKDVPILF
LSGLKDELVPPSNMTQLFAVCKSSRKVWRTLPNGGHNDTVAEPGYFEHIH
DFVMEEVVRSQN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDSPPPPPSWSIAAMANNAVHFLRLPVLASSGLAVVASGLLYFKQNELI
YPRNVPVDARTNVPSPRQFGLNDYEDLQIPTPDGESLHAFFIRPENKQHA
RNVTVLMFHGNAGNIGHRVPIAKVLQEVLSCNVLMLEYRGYGLSTGVPDE
AGLKVDAQTGLDYLRQRAETRDTKIVIYGQSIGGAVAINLVAENQDSGDV
GGLILENTFLSIRKLIPTVFPPARYLARLCHQYWTSEEVLPKIKDVPILF
LSGLKDELVPPSNMTQLFAVCKSSRKVWRTLPNGGHNDTVAEPGYFEHIH
DFVMEEVVRSQN

no DNA




Reference
    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer