Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspfu-AYG1

Aspergillus fumigatus (Sartorya fumigata) yellowish-green 1.Heptaketide hydrolyase ayg1

Relationship
Family|Duf_1100-S
Block| X
Position in NCBI Life Tree|Aspergillus fumigatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
O-Demethylfonsecin
No inhibitor
2 Genbank : AAHF01000001, AF116902
1 UniProt : Q4WZB3
2 UniProt : Q9UVV1, Q4WZB3
2 Interpro : Q9UVV1, Q4WZB3
2 Prodom : Q9UVV1, Q4WZB3
2 Pfam : Q9UVV1, Q4WZB3
2 PIRSF : Q9UVV1, Q4WZB3
2 SUPERFAM : Q9UVV1, Q4WZB3
Sequence
Graphical view for this peptide sequence: aspfu-AYG1
Colored MSA for Duf_1100-S (raw)
MPRWILGDKFDTVFPHKGSLKVLWESRWKFACSKSVYPFHDGSIEDFEPI
FNHLISKNINDAASDEYTQAFLPTASALEEKAAQALQAGKHEEASNLLCR
AAVVYRISRFPYVDITKPNSIKRVAFERQKQAYLKATSLWTQPIREVTVP
HTYRTGNDGAHIPIYIRTPAGADQSNPVPIVLIMTGLDGYRPDNSQRTHE
ILARGWAAVVAEIPGTADCPADPADPASPDRLWDSVLSYLDQRPELNTAK
MVVWGLSAGGYYAIRAAHTHRDRLLGAIAHGPGCHYYLDPEWLAKVNDHE
YPFEITAAWATKHGYKTVEEFVAGAQKKFSLVETGIVDQPSCRLLLLNGV
DDGVVPIEDCLVLFEHGSPKEGRFYKGLPHMGYPNSLPVSYEWLEQVLAS
PSKTKN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPRWILGDKFDTVFPHKGSLKVLWESRWKFACSKSVYPFHDGSIEDFEPI
FNHLISKNINDAASDEYTQAFLPTASALEEKAAQALQAGKHEEASNLLCR
AAVVYRISRFPYVDITKPNSIKRVAFERQKQAYLKATSLWTQPIREVTVP
HTYRTGNDGAHIPIYIRTPAGADQSNPVPIVLIMTGLDGYRPDNSQRTHE
ILARGWAAVVAEIPGTADCPADPADPASPDRLWDSVLSYLDQRPELNTAK
MVVWGLSAGGYYAIRAAHTHRDRLLGAIAHGPGCHYYLDPEWLAKVNDHE
YPFEITAAWATKHGYKTVEEFVAGAQKKFSLVETGIVDQPSCRLLLLNGV
DDGVVPIEDCLVLFEHGSPKEGRFYKGLPHMGYPNSLPVSYEWLEQVLAS
PSKTKN


References
9 more
    Title: Hydrolytic polyketide shortening by ayg1p, a novel enzyme involved in fungal melanin biosynthesis
    Fujii I, Yasuoka Y, Tsai HF, Chang YC, Kwon-Chung KJ, Ebizuka Y
    Ref: Journal of Biological Chemistry, 279:44613, 2004 : PubMed

            

    Title: Pentaketide melanin biosynthesis in Aspergillus fumigatus requires chain-length shortening of a heptaketide precursor
    Tsai HF, Fujii I, Watanabe A, Wheeler MH, Chang YC, Yasuoka Y, Ebizuka Y, Kwon-Chung KJ
    Ref: Journal of Biological Chemistry, 276:29292, 2001 : PubMed

            

    Title: A developmentally regulated gene cluster involved in conidial pigment biosynthesis in Aspergillus fumigatus.
    Tsai HF, Wheeler MH, Chang YC, Kwon-Chung KJ
    Ref: Journal of Bacteriology, 181:6469, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer