aspfu-DPP4

 
Aspergillus fumigatus (Sartorya fumigata), Neosartorya fischeri (Aspergillus fischerianus), proline dipeptidyl aminopeptidase IV

Comment
Other strains: Aspergillus fumigatus (Sartorya fumigata)(Af293; CEA10/CBS 144.89/FGSC A1163) Neosartorya fischeri (strain ATCC 1020/DSM 3700/FGSC A1164/NRR181) (Aspergillus fischerianus)


Relationship
Block X
Aspergillus fumigatus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Gly-Pro-pNA , Lys-Pro-MNA , Arg-Pro-pNA , Ala-Pro-pNA , Gly-Phe-pNA ,

>3 Genbank links 1 more: U87950, AAHF01000005, DS499598
3 UniProt : Q4WPH9, B0Y6C5, A1CX29
3 UniProtTrembl : Q4WPH9, B0Y6C5, A1CX29
3 Interpro : Q4WPH9, B0Y6C5, A1CX29
3 Prodom : Q4WPH9, B0Y6C5, A1CX29
3 Pfam : Q4WPH9, B0Y6C5, A1CX29
3 PIRSF : Q4WPH9, B0Y6C5, A1CX29
3 SUPERFAM : Q4WPH9, B0Y6C5, A1CX29
3 QuickSwissBlast : Q4WPH9, B0Y6C5, A1CX29
 
Sequence
Graphical view for this peptide sequence: aspfu-DPP4
Colored MSA for DPP4N_Peptidase_S9 (raw)
MKWSILLLVGCAAAIDVPRQPYAPTGSGKKRLTFNETVVKRAISPSAISV
EWISTSEDGDYVYQDQDGSLKIQSIVTNHTQTLVPADKVPEDAYSYWIHP
NLSSVLWATNYTKQYRHSYFADYFIQDVQSMKLRPLAPDQSGDIQYAQWS
PTGDAIAFVRGNNVFVWTNASTSQITNDGGPDLFNGVPDWIYEEEILGDR
FALWFSPDGAYLAFLRFNETGVPTFTVPYYMDNEEIAPPYPRELELRYPK
VSQTNPTVELNLLELRTGERTPVPIDAFDAKELIIGEVAWLTGKHDVVAV
KAFNRVQDRQKVVAVDVASLRSKTISERDGTDGWLDNLLSMAYIGPIGES
KEEYYIDISDQSGWAHLWLFPVAGGEPIALTKGEWEVTNILSIDKPRQLV
YFLSTKHHSTERHLYSVSWKTKEITPLVDDTVPAVWSASFSSQGGYYILS
YRGPDVPYQDLYAINSTAPLRTITSNAAVLNALKEYTLPNITYFELALPS
GETLNVMQRLPVKFSPKKKYPVLFTPYGGPGAQEVSKPWQALDFKAYIAS
DPELEYITWTVDNRGTGYKGRAFRCQVASRLGELEAADQVFAAQQAAKLP
YVDAQHIAIWGWSYGGYLTGKVIETDSGAFSLGVQTAPVSDWRFYDSMYT
ERYMKTLESNAAGYNASAIRKVAGYKNVRGGVLIQHGTGDDNVHFQNAAA
LVDTLVGAGVTPEKLQVQWFTDSDHGIRYHGGNVFLYRQLSKRLYEEKKR
KEKGEAHQWSKKSVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKWSILLLVGCAAAIDVPRQPYAPTGSGKKRLTFNETVVKRAISPSAISV
EWISTSEDGDYVYQDQDGSLKIQSIVTNHTQTLVPADKVPEDAYSYWIHP
NLSSVLWATNYTKQYRHSYFADYFIQDVQSMKLRPLAPDQSGDIQYAQWS
PTGDAIAFVRGNNVFVWTNASTSQITNDGGPDLFNGVPDWIYEEEILGDR
FALWFSPDGAYLAFLRFNETGVPTFTVPYYMDNEEIAPPYPRELELRYPK
VSQTNPTVELNLLELRTGERTPVPIDAFDAKELIIGEVAWLTGKHDVVAV
KAFNRVQDRQKVVAVDVASLRSKTISERDGTDGWLDNLLSMAYIGPIGES
KEEYYIDISDQSGWAHLWLFPVAGGEPIALTKGEWEVTNILSIDKPRQLV
YFLSTKHHSTERHLYSVSWKTKEITPLVDDTVPAVWSASFSSQGGYYILS
YRGPDVPYQDLYAINSTAPLRTITSNAAVLNALKEYTLPNITYFELALPS
GETLNVMQRLPVKFSPKKKYPVLFTPYGGPGAQEVSKPWQALDFKAYIAS
DPELEYITWTVDNRGTGYKGRAFRCQVASRLGELEAADQVFAAQQAAKLP
YVDAQHIAIWGWSYGGYLTGKVIETDSGAFSLGVQTAPVSDWRFYDSMYT
ERYMKTLESNAAGYNASAIRKVAGYKNVRGGVLIQHGTGDDNVHFQNAAA
LVDTLVGAGVTPEKLQVQWFTDSDHGIRYHGGNVFLYRQLSKRLYEEKKR
KEKGEAHQWSKKSVL

no DNA




References
    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            

    Title: Dipeptidyl-peptidase IV secreted by Aspergillus fumigatus, a fungus pathogenic to humans
    Beauvais A, Monod M, Wyniger J, Debeaupuis JP, Grouzmann E, Brakch N, Svab J, Hovanessian AG, Latge JP
    Ref: Infect Immun, 65:3042, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer