Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspfu-PKSP

Aspergillus fumigatus (Sartorya fumigata) polyketide synthase Thioesterase domain

Comment
Other strains: Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) (Aspergillus fischerianus)Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) Q4WZA8 strain Af293 thioesterase domain 1801 2146


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Aspergillus fumigatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aspfu-PKSP
Colored MSA for Thioesterase (raw)
MGMDSLLSLTVLGRIRETLGMDLPAEFFLENPTLDAVQAALDLKPKMVPA
ATPVSEPIRLLETIDNTKPKTSRHPPATSILLQGNPHTATKKLFMFPDGS
GSASSYATIPALSPDVCVYGLNCPYMKTPQNLTCSLDELTEPYLAEIRRR
QPKGPYSFGGWSAGGICAFDAARQLILEEGEEVERLLLLDSPFPIGLEKL
PPRLYKFFNSIGLFGDGKRAPPDWLLPHFLAFIDSLDAYKAVPLPFNDSK
WAKKMPKTYLIWAKDGVCGKPGDPRPEPAEDGSEDPREMQWLLNDRTDLG
PNKWDTLVGPQNIGGIHVMEDANHFTMTTGQKAKELSQFMATAMSS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGMDSLLSLTVLGRIRETLGMDLPAEFFLENPTLDAVQAALDLKPKMVPA
ATPVSEPIRLLETIDNTKPKTSRHPPATSILLQGNPHTATKKLFMFPDGS
GSASSYATIPALSPDVCVYGLNCPYMKTPQNLTCSLDELTEPYLAEIRRR
QPKGPYSFGGWSAGGICAFDAARQLILEEGEEVERLLLLDSPFPIGLEKL
PPRLYKFFNSIGLFGDGKRAPPDWLLPHFLAFIDSLDAYKAVPLPFNDSK
WAKKMPKTYLIWAKDGVCGKPGDPRPEPAEDGSEDPREMQWLLNDRTDLG
PNKWDTLVGPQNIGGIHVMEDANHFTMTTGQKAKELSQFMATAMSS


References
1 more
    Title: A developmentally regulated gene cluster involved in conidial pigment biosynthesis in Aspergillus fumigatus.
    Tsai HF, Wheeler MH, Chang YC, Kwon-Chung KJ
    Ref: Journal of Bacteriology, 181:6469, 1999 : PubMed

            

    Title: Identification of a polyketide synthase gene (pksP) of Aspergillus fumigatus involved in conidial pigment biosynthesis and virulence.
    Langfelder K, Jahn B, Gehringer H, Schmidt A, Wanner G, Brakhage AA
    Ref: Med Microbiol Immunol, 187:79, 1998 : PubMed

            

    Title: The developmentally regulated alb1 gene of Aspergillus fumigatus: its role in modulation of conidial morphology and virulence.
    Tsai HF, Chang YC, Washburn RG, Wheeler MH, Kwon-Chung KJ
    Ref: Journal of Bacteriology, 180:3031, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer