aspfu-apth1

 
Aspergillus fumigatus Af293 (Sartorya fumigata) phospholipase, putative

Relationship
Block X
Aspergillus fumigatus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AAHF01000012
1 UniProt : Q4WCX7
1 UniProtTrembl : Q4WCX7
1 Interpro : Q4WCX7
1 Prodom : Q4WCX7
1 Pfam : Q4WCX7
1 PIRSF : Q4WCX7
1 SUPERFAM : Q4WCX7
1 QuickSwissBlast : Q4WCX7
 
Sequence
Graphical view for this peptide sequence: aspfu-apth1
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MAPPRAPYIVPALKKHTATVIMAHGLGDRMSLAQNWRRRGMFDEVAFIFP
NAPMIPITVNFGMTMPGWHDLTKLGRELDYESAIRHQDEPGVLRSRDYFN
TLIKEQIDKGIKPSRIVLGGFSQGAAISVFTGITCKEKLGGVFGLSSYLV
LSDKLKNYIPENWPNKKTPFFLAHGLEDEIVLFDFGDLSAKKMKEIGLED
VTFKSYPNLGHSADPVEIEDLARFLQKVIPPEDDGQASAGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPPRAPYIVPALKKHTATVIMAHGLGDRMSLAQNWRRRGMFDEVAFIFP
NAPMIPITVNFGMTMPGWHDLTKLGRELDYESAIRHQDEPGVLRSRDYFN
TLIKEQIDKGIKPSRIVLGGFSQGAAISVFTGITCKEKLGGVFGLSSYLV
LSDKLKNYIPENWPNKKTPFFLAHGLEDEIVLFDFGDLSAKKMKEIGLED
VTFKSYPNLGHSADPVEIEDLARFLQKVIPPEDDGQASAGL

no DNA




Reference
    Title: Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus
    Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, Berriman M, Abe K, Archer DB and Denning DW <87 more author(s)>
    Ref: Nature, 438:1151, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer