aspfu-apth1
Aspergillus fumigatus Af293 (Sartorya fumigata) phospholipase, putative
Relationship
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain. > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
6_AlphaBeta_hydrolase :
aspfu-q4wm12 Aspergillus fumigatus Af293 Neosartorya fischeri (Aspergillus fischerianus strain ATCC 1020 / DSM 3700 / NRRL 181) alpha/beta hydrolase, putative ,
aspfu-q4wqj8 Aspergillus fumigatus Af293 Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181) alpha/beta hydrolase, putative ,
aspfu-q6myz3 Aspergillus fumigatus (Sartorya fumigata) (and Af293) esterase/lipase/thioesterase family protein, putative .
A85-IroE-IroD-Fes-Yiel :
aspfu-q4wf29 Aspergillus fumigatus Af293 and Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus) Siderophore esterase IroE-like AfEstB.
Carboxypeptidase_S10 :
aspfu-CBPYA Aspergillus fumigatus (Sartorya fumigata) Neosartorya fumigata (Aspergillus fischerianus), carboxypeptidase 3 ,
aspfu-q5vjg7 Neosartorya fumigata (Aspergillus fumigatus), Neosartorya fischeri (Aspergillus fischerianus) carboxypeptidase 5 ,
aspfu-q5vjg8 Aspergillus fumigatus (Sartorya fumigata), Neosartorya fischeri carboxypeptidase 4 ,
aspfu-q5vjh0 Neosartorya fumigata (Aspergillus fumigatus), Neosartorya fischeri (Aspergillus fischerianus) carboxypeptidase 2 ,
aspfu-q5vjk9 Aspergillus fumigatus (Sartorya fumigata) carboxypeptidase 1 .
DPP4N_Peptidase_S9 :
aspfu-DPP4 Aspergillus fumigatus (Sartorya fumigata), Neosartorya fischeri (Aspergillus fischerianus), proline dipeptidyl aminopeptidase IV .
Duf_726 :
aspfu-q4wk44 Aspergillus fumigatus (Sartorya fumigata) (strain CEA10 / CBS 144.89 / FGSC A1163) DUF726 domain protein ,
aspfu-q4x0n6 Aspergillus fumigatus (Sartorya fumigata) (strain CEA10 / CBS 144.89 / FGSC A1163) (Sartorya fumigata) DUF726 domain protein .
Duf_829 :
aspfu-q4wa39 Aspergillus fumigatus (Sartorya fumigata) DUF829 domain protein (PaxU), putative ,
aspfu-q4wkh6 Aspergillus fumigatus (Sartorya fumigata) Indole-diterpene biosynthesis protein PaxU, putative .
Duf_1100-S :
aspfu-AYG1 Aspergillus fumigatus (Sartorya fumigata) yellowish-green 1.Heptaketide hydrolyase ayg1 .
Duf_1749 :
aspfu-q4wa78 Aspergillus fumigatus (Sartorya fumigata), Neosartorya fumigata, Neosartorya fischeri (Aspergillus fischerianus), hypothetical protein ,
aspfu-q4wf56 Aspergillus fumigatus (Sartorya fumigata) Neosartorya fumigata, Neosartorya fischeri (Aspergillus fischerianus) AfSidJ Siderophore fusarinine C hydrolase,
aspfu-q4wxr1 Aspergillus fumigatus (Sartorya fumigata), Neosartorya fumigata, Neosartorya fischeri, (Aspergillus fischerianus), hypothetical protein .
Epoxide_hydrolase :
aspfu-q4wuk8 Aspergillus fumigatus, Neosartorya fumigata (Aspergillus fumigatus), Neosartorya fischeri epoxide hydrolase, putative ,
aspfu-q4wzh6 Aspergillus fumigatus, Neosartorya fischeri (Aspergillus fischerianus) epoxide hydrolase, putative .
Esterase_phb :
aspfu-axe1 Aspergillus fumigatus (Sartorya fumigata) Probable acetylxylan esterase A .
FaeC :
aspfu-faec Aspergillus fumigatus (Sartorya fumigata) Ferulic acid esterase C faeC, afu2g14530 .
Fungal-Bact_LIP :
aspfu-q4wf06 Aspergillus fumigatus (strains Af293; CEA10 / CBS 144.89 / FGSC A1163)(Sartorya fumigata) lipase, putative .
Fungal_carboxylesterase_lipase :
aspfu-q4x1w9 Aspergillus fumigatus carboxylesterase, putative ,
aspfm-a0a0j5pn99 Aspergillus fumigatus Uncharacterized protein ,
aspfm-a0a0j5pq59 Aspergillus fumigatus Uncharacterized protein ,
aspfm-a0a0j5q3a0 Aspergillus fumigatus Uncharacterized protein .
Glucuronoyl_esterase :
aspfm-a0a0j5q4b6 Aspergillus fumigatus (Aspergillus fumigatus) Extracelular cellulose binding protein (Cip2) ,
neofi-a1dpe9 Aspergillus fumigatus; Aspergillus Neosartorya fischeri (Aspergillus fischerianus) Uncharacterized protein .
Homoserine_transacetylase :
aspfu-q4wu51 Aspergillus fumigatus, Neosartorya fischeri (Aspergillus fischerianus) Aspergillus clavatus homoserine o-acetyltransferase, putative .
Hormone-sensitive_lipase_like :
aspfu-q6myf7 Aspergillus fumigatus (Sartorya fumigata) esterase/lipase/thioesterase family protein, putative(and strain Af293) 6-hexanolactone hydrolase, putative .
LIDHydrolase :
aspfu-q4wub2 Aspergillus fumigatus (strain CEA10 / CBS 144.89 / FGSC A1163 (Sartorya fumigata) Putative uncharacterized protein .
Lipase_3 :
aspfu-atg15 Aspergillus fumigatus (Sartorya fumigata) putative lipase atg15 (EC 3.1.1.3) (autophagy-related protein 15) .
LYsophospholipase_carboxylesterase :
aspfu-q6my76 Neosartorya fumigata (Aspergillus fumigatus) (Sartorya fumigata) (and strain Af293) hypothetical protein .
PPase_methylesterase_euk :
aspfu-ppme1 Aspergillus fumigatus (Sartorya fumigata), Neosartorya fumigata, Neosartorya fischeri (Aspergillus fischerianus) Protein phosphatase methylesterase 1 .
Prolyl_oligopeptidase_S9 :
aspfc-dpp5 Aspergillus fumigatus (strain CEA10/CBS 144.89/FGSC A1163) (Sartorya fumigata)(and strain Af293) Dipeptidyl-peptidase V .
Thioesterase :
aspfu-PKSP Aspergillus fumigatus (Sartorya fumigata) polyketide synthase Thioesterase domain Molecular evidence
Database
No mutation No structure No kinetic
Sequence
Graphical view for this peptide sequence: aspfu-apth1 Colored MSA for LYsophospholipase_carboxylesterase (raw)
MAPPRAPYIVPALKKHTATVIMAHGLGDRMSLAQNWRRRGMFDEVAFIFP
NAPMIPITVNFGMTMPGWHDLTKLGRELDYESAIRHQDEPGVLRSRDYFN
TLIKEQIDKGIKPSRIVLGGFSQGAAISVFTGITCKEKLGGVFGLSSYLV
LSDKLKNYIPENWPNKKTPFFLAHGLEDEIVLFDFGDLSAKKMKEIGLED
VTFKSYPNLGHSADPVEIEDLARFLQKVIPPEDDGQASAGL
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
M A P P R A P Y I V P A L K K H T A T V I M A H G L G D R M S L A Q N W R R R G M F D E V A F I F P N A P M I P I T V N F G M T M P G W H D L T K L G R E L D Y E S A I R H Q D E P G V L R S R D Y F N T L I K E Q I D K G I K P S R I V L G G F S Q G A A I S V F T G I T C K E K L G G V F G L S S Y L V L S D K L K N Y I P E N W P N K K T P F F L A H G L E D E I V L F D F G D L S A K K M K E I G L E D V T F K S Y P N L G H S A D P V E I E D L A R F L Q K V I P P E D D G Q A S A G L no DNA
Reference
Title: Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus
Nierman WC , Pain A , Anderson MJ , Wortman JR , Kim HS , Arroyo J , Berriman M , Abe K , Archer DB and Denning DW <87 more author(s)>
Nierman WC , Pain A , Anderson MJ , Wortman JR , Kim HS , Arroyo J , Berriman M , Abe K , Archer DB , Bermejo C , Bennett J , Bowyer P , Chen D , Collins M , Coulsen R , Davies R , Dyer PS , Farman M , Fedorova N , Feldblyum TV , Fischer R , Fosker N , Fraser A , Garcia JL , Garcia MJ , Goble A , Goldman GH , Gomi K , Griffith-Jones S , Gwilliam R , Haas B , Haas H , Harris D , Horiuchi H , Huang J , Humphray S , Jimenez J , Keller N , Khouri H , Kitamoto K , Kobayashi T , Konzack S , Kulkarni R , Kumagai T , Lafon A , Latge JP , Li W , Lord A , Lu C , Majoros WH , May GS , Miller BL , Mohamoud Y , Molina M , Monod M , Mouyna I , Mulligan S , Murphy L , O'Neil S , Paulsen I , Penalva MA , Pertea M , Price C , Pritchard BL , Quail MA , Rabbinowitsch E , Rawlins N , Rajandream MA , Reichard U , Renauld H , Robson GD , Rodriguez de Cordoba S , Rodriguez-Pena JM , Ronning CM , Rutter S , Salzberg SL , Sanchez M , Sanchez-Ferrero JC , Saunders D , Seeger K , Squares R , Squares S , Takeuchi M , Tekaia F , Turner G , Vazquez de Aldana CR , Weidman J , White O , Woodward J , Yu JH , Fraser C , Galagan JE , Asai K , Machida M , Hall N , Barrell B , Denning DW (- 87)
Ref: Nature, 438 :1151, 2005 : PubMed Abstract ESTHER: Nierman_2005_Nature_438_1151 PubMedSearch: Nierman 2005 Nature 438 1151 PubMedID: 16372009 Gene_locus related to this paper: aspfc-b0xp50 ,
aspfc-b0xu40 ,
aspfc-b0xzj6 ,
aspfc-dpp5 ,
aspfu-apth1 ,
aspfu-axe1 ,
aspfu-CBPYA ,
aspfu-faec ,
aspfu-kex1 ,
aspfu-ppme1 ,
aspfu-q4wa39 ,
aspfu-q4wa78 ,
aspfu-q4wf56 ,
aspfu-q4wg73 ,
aspfu-q4wk44 ,
aspfu-q4wkh6 ,
aspfu-q4wnx3 ,
aspfu-q4wpb9 ,
aspfu-q4wqv2 ,
aspfu-q4wub2 ,
aspfu-q4wxr1 ,
aspfu-q4x0n6 ,
aspfu-q4x1n0 ,
aspfu-q5vjg7 ,
neofi-a1cwa6 ,
neofi-a1dfr9 ,
aspfm-a0a084bf80 ,
aspfu-fmac Abstract
Aspergillus fumigatus is exceptional among microorganisms in being both a primary and opportunistic pathogen as well as a major allergen. Its conidia production is prolific, and so human respiratory tract exposure is almost constant. A. fumigatus is isolated from human habitats and vegetable compost heaps. In immunocompromised individuals, the incidence of invasive infection can be as high as 50% and the mortality rate is often about 50% (ref. 2). The interaction of A. fumigatus and other airborne fungi with the immune system is increasingly linked to severe asthma and sinusitis. Although the burden of invasive disease caused by A. fumigatus is substantial, the basic biology of the organism is mostly obscure. Here we show the complete 29.4-megabase genome sequence of the clinical isolate Af293, which consists of eight chromosomes containing 9,926 predicted genes. Microarray analysis revealed temperature-dependent expression of distinct sets of genes, as well as 700 A. fumigatus genes not present or significantly diverged in the closely related sexual species Neosartorya fischeri, many of which may have roles in the pathogenicity phenotype. The Af293 genome sequence provides an unparalleled resource for the future understanding of this remarkable fungus.
         Other Papers